(data stored in ACNUC9543 zone)

EMBL: CP000308.PE324

CP000308.PE324       Location/Qualifiers
FT   CDS_pept        385470..386594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0325"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12293"
FT                   /db_xref="GOA:A0A0E1NTF7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006321"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTF7"
FT                   /protein_id="ABG12293.1"
FT                   /translation="MDFTSLNNQHSDLNNPVFSRIKAKRIDLENPDLASDGFNKQDFAN
FT                   KVAASVDHNASDLHLCTGFHPVLRIDGELKTFTDWPKVTAGWLNGLRRHMLSDAQESRL
FT                   QQQGQVDCAYTTVGSQRLRANIFQQRQGQSIAFRIIPAICPSLTQLAAPPILNQLIQQD
FT                   NGLILVTGATGSGKSTTLSAMISAINQQQARHIITLEDPIEFIHSSQSCLIQQRELGRH
FT                   THCFSRALNGALRQDPDIILLGELRDLETIRLALTAAETGHLVLATLHTRTATQAIDRL
FT                   IDVFPPEEKAVIRTQLAASLRGVITQKLCRQNGGGRIAVFEILTQTTAVSHLIREGKTY
FT                   QLPTVIQAGGQWGMQTFEQSIAQRQKQGVLAINH"
     atggatttca caagcctgaa taatcaacat tcagatctga ataaccccgt gtttagccgt        60
     ataaaagcca aacgcattga tttagaaaac cctgaccttg ccagtgatgg ctttaacaaa       120
     caggattttg ccaataaggt ggcggctagt gtagatcata atgcttcaga tctgcacctc       180
     tgtaccggtt ttcaccccgt attacgtatc gatggcgagc taaaaacctt tactgactgg       240
     ccgaaggtca ctgctggttg gttaaatggg ctacgtcggc atatgttgag tgacgcacaa       300
     gaaagccgat tacagcaaca ggggcaggtt gactgtgcct ataccaccgt gggcagtcaa       360
     aggttacggg cgaatatttt ccagcaacga cagggccaat ccattgcttt tcgcattatt       420
     cctgctattt gtccgtcact gacacaattg gcggcaccac ctattttgaa ccaattgatt       480
     caacaggata atggactaat tctggtaacg ggggcgacgg gcagcggtaa atcgacgacg       540
     ctgagtgcca tgataagcgc gattaatcag caacaggcac gacatattat tacccttgag       600
     gacccgattg aatttattca tagcagtcaa tcatgtttga tccagcaacg agagcttggt       660
     cgccatactc actgttttag tcgtgccctg aatggggcat tacgtcagga tccagatatt       720
     attttactcg gagagttacg ggatctggag actatccgat tagcgctgac agcagcagaa       780
     accgggcatc tggtgctagc cacattgcat acccgcacgg caacacaggc tattgatcgg       840
     ctgattgatg tttttcctcc tgaggagaaa gccgttatac ggacgcaact ggctgccagt       900
     ttacgcggtg ttatcacgca gaaattgtgt cgtcaaaatg gcggtgggcg tatagctgta       960
     tttgagatac tcacgcaaac cacggcagtc agccatttga tccgagaagg taaaacctat      1020
     caattaccaa ccgtgataca ggccggaggg caatggggga tgcaaacctt tgagcaaagt      1080
     atcgcacaac ggcaaaaaca gggggttttg gctatcaatc actga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page