(data stored in ACNUC9543 zone)

EMBL: CP000308.PE325

CP000308.PE325       Location/Qualifiers
FT   CDS_pept        complement(386703..387818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12294"
FT                   /db_xref="GOA:A0A0H2Y4X0"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4X0"
FT                   /protein_id="ABG12294.1"
FT                   /translation="MSVQDTMLQQQALPGTPRQDGFFMPAEWAPQDAVWMLWPYRQDNW
FT                   RGKAIPAQQTFAKVAEAISRATPVFMGVPAEFMAQAKATMPANVTLVEMASDDAWMRDT
FT                   GPTMVINGAAERRAVDWQFNAWGGLNGGLYADWQQDEKVAVQVSDFLKNAHYSAPLILE
FT                   GGSIHTDGEGTLLTTAECLLNPNRNPHLNQAQIEQLLCDYLGVTHFIWLQDGVYNDETD
FT                   GHIDNMCCFVRPGEVALHWTDDQQDPQYARSVAAFEVLSNTVDAKGRKLKIWKLPAPGP
FT                   LYNTEEETFDVLTSDAVPRTAGERLAGSYVNFLISNQQIIFPLLDSRTDGQANDLLQQM
FT                   FPGYAIVGVPAREILLGGGNIHCITQQIPAA"
     atgtcggtgc aagacacgat gttacaacaa caggcattac ccggcacacc gcggcaggat        60
     ggtttcttta tgcctgcaga atgggcaccg caggatgcgg tatggatgct ttggccatat       120
     cgtcaggata actggcgcgg caaagctatt cccgctcagc agacattcgc caaagtcgcc       180
     gaggccatta gccgtgctac gccagtcttt atgggcgttc ccgccgagtt tatggcacaa       240
     gccaaggcaa ccatgccggc gaatgtgacc ttagtggaaa tggccagtga cgatgcctgg       300
     atgcgtgata caggcccaac gatggtgatt aatggtgcgg ccgagcgccg ggccgttgac       360
     tggcagttta atgcatgggg cggcctgaac ggtggcttgt atgctgactg gcaacaagat       420
     gaaaaagttg ccgttcaagt cagtgatttt ctgaaaaacg cgcattacag tgcaccgttg       480
     atactggaag gtggctccat tcatactgat ggcgaaggca cgttactcac cactgctgaa       540
     tgtttgctaa acccgaatcg caacccacat ttgaatcaag cgcaaatcga acagttactg       600
     tgtgactatc tgggggtgac tcacttcatt tggttgcaag atggcgtgta taacgatgag       660
     accgatggtc atatcgataa tatgtgctgt tttgtccgcc caggcgaagt agccctgcat       720
     tggacagacg accagcagga tccacagtat gcacgttcag tcgcagcgtt cgaggtgtta       780
     tccaataccg tcgatgccaa agggcgtaaa ctgaaaatct ggaagttacc ggctcccggc       840
     ccgctttata acacggaaga ggaaaccttc gatgtgttga ccagcgatgc ggttccccgc       900
     acggcgggtg aacgcctggc gggctcttat gtcaacttcc tgatcagtaa ccagcaaatt       960
     attttcccac tgctggatag ccgcactgac gggcaggcta acgatctgtt acaacaaatg      1020
     ttccccggct atgcaattgt cggcgtgcct gccagagaga ttttactcgg tggcggtaac      1080
     atacattgca ttactcagca gatcccagcg gcttaa                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page