(data stored in ACNUC9543 zone)

EMBL: CP000308.PE327

CP000308.PE327       Location/Qualifiers
FT   CDS_pept        complement(388886..389308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0328"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12296"
FT                   /db_xref="GOA:Q1CB76"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB76"
FT                   /protein_id="ABG12296.1"
FT                   /translation="MANRTIIAFDFGTKSIGVAIGQEVTGTARALTAFKAQDGTPDWQQ
FT                   VEKLLKEWQPNLVVVGLPLNMDGTEQPLTARARRFANRLHGRFGVQVALQDERLSTVEA
FT                   RANLFDRGGYRALDKGSVDAASAVIILESWFDEQAG"
     atggctaatc gcacaattat tgcttttgat tttggtacca aaagtatcgg tgtcgccatc        60
     ggtcaggaag tcaccggaac ggccagagcg ctaaccgcgt ttaaagcaca agatggcacc       120
     ccggattggc agcaagtcga aaagctgttg aaagagtggc agcccaattt agtggtagtc       180
     ggcctgccgc tcaatatgga tggcactgaa caaccactaa ccgccagagc tcgtcggttt       240
     gccaaccgtc tgcatgggcg ctttggtgta caggtcgcct tacaggatga acgcctcagt       300
     acggtagaag cccgcgccaa tctgtttgac cgcggtggct atcgcgctct ggataaaggc       360
     agtgtcgatg cagcctctgc ggtgatcatt ttggaaagct ggtttgatga gcaagcaggt       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page