(data stored in ACNUC9543 zone)

EMBL: CP000308.PE333

CP000308.PE333       Location/Qualifiers
FT   CDS_pept        complement(392760..393317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12302"
FT                   /db_xref="GOA:A0A0H2Y3T3"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR023483"
FT                   /db_xref="InterPro:IPR035240"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3T3"
FT                   /protein_id="ABG12302.1"
FT                   /translation="MSACIWLSTVLFFRIMSTLRIPIALQQAVMQCLRHYLQLANQHLG
FT                   TAYPEPKVNYHQRGTNAGSAYLQSFEIRLNPVLLLENKQPFIDEVVPHELAHLLVYRQF
FT                   GRVAPHGKEWRWMMEQVLKVPASRTHQFEVASVRSKTFNYQCKCQQHALTIRRHNKVLR
FT                   GESEYRCRQCGEKLQFITINPD"
     atgtcagctt gcatctggct atccaccgtt ttattcttcc gcattatgag cacactaaga        60
     atccccatcg cactccaaca agcggttatg cagtgtctgc gtcactattt gcaactggct       120
     aaccagcatc ttggcaccgc gtatccagag ccaaaagtca attaccatca gcgtggtacc       180
     aacgcgggca gtgcctatct gcaatcattc gaaattcgtc ttaacccagt gttattgctg       240
     gagaataagc agccgtttat tgatgaagtc gtaccacatg aattagcaca cttgctggtt       300
     taccgccaat tcggccgcgt agccccccat ggcaaagaat ggcgctggat gatggaacag       360
     gtcttaaaag tacccgctag ccgcacccac caattcgaag tggcgtcagt gcgcagtaag       420
     accttcaatt atcaatgcaa atgtcagcaa catgctttaa ccattcgccg tcacaataaa       480
     gtgctgcgag gagagagtga atatcgctgc cggcagtgtg gggagaaact ccagttcatc       540
     acaataaatc ctgattaa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page