(data stored in ACNUC9543 zone)

EMBL: CP000308.PE337

CP000308.PE337       Location/Qualifiers
FT   CDS_pept        398675..398995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0338"
FT                   /product="putative Rieske protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12306"
FT                   /db_xref="GOA:A0A0E1NNC1"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNC1"
FT                   /protein_id="ABG12306.1"
FT                   /translation="MGWFSVCKVNDIKPDFPFSAQAGNNRVGIYLVEGEYFAMEDICPH
FT                   AYALLSQGINDGEIIECPLHGALFNVRTGQCLREPGDRDLNTYAVRINGDQIDVNLDGD
FT                   GE"
     atgggctggt tcagcgtctg taaggtgaat gatatcaaac cagatttccc gttttcggct        60
     caagcgggta ataacagagt gggtatttat ctggtggagg gcgagtattt tgcgatggaa       120
     gatatttgtc ctcatgccta tgcattacta agccaaggaa ttaatgatgg tgaaatcatt       180
     gaatgcccgc tacatggtgc tctgtttaat gtgcggacag ggcagtgttt gcgtgagccg       240
     ggcgatcgcg atttaaacac ctatgctgtg cggatcaatg gcgatcagat cgacgttaat       300
     ttggatggcg atggcgagta g                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page