(data stored in ACNUC9543 zone)

EMBL: CP000308.PE34

CP000308.PE34        Location/Qualifiers
FT   CDS_pept        50325..51236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0034"
FT                   /product="maltose operon periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12003"
FT                   /db_xref="GOA:A0A0E1NYD4"
FT                   /db_xref="InterPro:IPR010794"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYD4"
FT                   /protein_id="ABG12003.1"
FT                   /translation="MKKNLLSLCLVLALGGTAPLAVQAASTISPANVSIAPTISTTTLQ
FT                   QLPWQPLVPPVTQDIQLTAGSPHISQGEVEGAVAAFALPADRGSLEVTLSSLLTDKQLF
FT                   TPSVLVLDEQMRPAAYYPSSYFTYEKAGIMINDRLQGVMKLTPALGQKQIYLLVYTTRD
FT                   DLKKTTQLLDPAKAYAQGVGNAVPDIPDPIVNHSPTGTLRIKVTSEQGMGNIMIGLIQS
FT                   APTSAPVVVGSSIQPVAAPQSEPAKPAAPMLGETENYFNQAIKDAVKAGDVDKALKLLN
FT                   EAEHLGSTSARKTFIGSVKGKG"
     atgaaaaaga atctgctgtc actctgtctg gtactggctt tagggggcac tgcacctctg        60
     gcagtacagg ccgcatcaac catttctccg gcgaatgtct ctattgcgcc aacgatcagt       120
     accaccacat tacagcagtt gccatggcag cctttggtgc caccggtgac gcaagatatt       180
     caacttactg cgggcagccc gcatatttct cagggtgagg ttgaaggcgc ggtagccgct       240
     tttgccttgc ctgcggatcg cggttcattg gaagtcacgc tcagcagttt gctcacggat       300
     aagcagctct ttacaccgag cgtattggtg ttggatgagc aaatgcggcc agcggcttat       360
     tacccgtcca gctatttcac ctatgaaaaa gcgggcatca tgatcaatga tcgcctgcaa       420
     ggcgtgatga aattgacgcc agcgttgggc cagaaacaaa tttacctgct ggtctatacc       480
     actcgcgatg atttgaagaa aaccacacaa ttgctcgatc cggcaaaagc gtacgcacaa       540
     ggtgtgggta atgccgtccc agatatcccg gaccccattg tcaatcactc cccaacaggg       600
     actttaagaa ttaaggtaac gtctgagcaa ggcatgggca atattatgat tggcttgatc       660
     cagtcggcac cgacctcggc tccggtcgtg gtgggcagca gtattcaacc cgtggctgcg       720
     ccacaatcag aaccggcgaa acctgcagca ccgatgctgg gtgagactga aaactacttc       780
     aaccaggcga ttaaagatgc ggtgaaagcc ggtgatgtcg ataaggcgct gaaattgttg       840
     aacgaagcgg aacatttggg ctcaacttca gcccgaaaaa cctttattgg tagtgtaaaa       900
     ggcaagggtt aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page