(data stored in ACNUC9543 zone)

EMBL: CP000308.PE342

CP000308.PE342       Location/Qualifiers
FT   CDS_pept        404747..405910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0343"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12311"
FT                   /db_xref="GOA:Q1CB61"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB61"
FT                   /protein_id="ABG12311.1"
FT                   /translation="MSVIKMTDLDLAGKRVLIRADLNVPVKEGKVTSDARIRASLPTIE
FT                   AALKQGAKVMVTSHLGRPTEGEYNEEFSLLPVVNYLKEKLSSPVRLAKDYLDGVEIAAG
FT                   ELVVLENVRFNKGEKKDDEALSKKYAALCDVYVMDAFGTAHRAQASTHGVGKFAPIACA
FT                   GPLLSAELEALGKALGNPARPMVAIVGGSKVSTKLTVLGALSKIADKLIVGGGIANTFV
FT                   AAQGHNVGKSLYEADLIPEAKRLLETCDIPVPTDVRVATEFSETAAATLKPANEIKDDE
FT                   QILDLGDESAERLAEILKNAKTILWNGPVGVFEFPNFRKGTEIVARAIAESEAFSIAGG
FT                   GDTLAAIDLFGIADQISYISTGGGAFLEFVEGKKLPAVVMLEERAKQ"
     atgtctgtaa ttaagatgac cgatctggat ctggctggca aacgtgtttt gatccgtgcg        60
     gacctcaatg ttccggtaaa agaaggcaaa gtgacttctg atgcgcgtat ccgtgcctct       120
     ctgccaacta tcgaagcggc attgaagcaa ggcgctaaag taatggttac ctctcacttg       180
     ggtcgcccga ccgaaggcga gtacaacgaa gagttctcct tactgcccgt cgttaactac       240
     ctgaaagaga agttatcttc tccggtacgt ctggcgaagg actatctgga cggcgttgaa       300
     attgcagctg gcgagttggt tgttctggaa aacgttcgct ttaacaaagg cgagaaaaaa       360
     gacgacgaag ccctgtccaa gaaatatgcc gcactgtgcg atgtttatgt gatggatgct       420
     tttggtaccg ctcaccgcgc tcaggcatcg actcacggtg tgggtaaatt tgcccctatc       480
     gcttgcgccg gcccgctgtt gtcagcagag ctggaagcat tgggtaaagc gctgggtaac       540
     ccagcgcgtc caatggttgc tatcgttggt ggctctaaag tttcaactaa actgaccgtg       600
     ctgggcgcgt tgtctaaaat cgcggataaa ctgattgttg gcggtggtat cgctaatacc       660
     ttcgttgcgg ctcaaggcca caatgtcggt aaatctctgt acgaagctga tctgatccca       720
     gaagcgaaaa gactgctaga gacctgtgat atccctgttc ctactgatgt tcgtgttgcc       780
     actgagttct ctgaaacggc agccgcgacg ctgaaacccg cgaacgaaat taaagatgac       840
     gaacaaattt tggatctggg cgacgaatct gcggagcgtc tggctgagat cctgaaaaat       900
     gccaaaacca ttctgtggaa tggtccggtt ggtgtgttcg agttccctaa cttccgtaaa       960
     gggaccgaga tcgtggctcg cgccattgca gaaagcgaag cattttctat cgcaggcggt      1020
     ggtgatactt tggcagcaat cgatctcttc ggtattgctg accaaatctc ctacatttct      1080
     actggcggtg gtgctttcct ggagttcgtc gaagggaaaa aactgcctgc cgtagtgatg      1140
     ctggaagagc gcgctaagca gtaa                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page