(data stored in ACNUC9543 zone)

EMBL: CP000308.PE346

CP000308.PE346       Location/Qualifiers
FT   CDS_pept        complement(409196..409975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0347"
FT                   /product="insertion sequence IS100, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12315"
FT                   /db_xref="GOA:Q1BZX6"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:Q1BZX6"
FT                   /protein_id="ABG12315.1"
FT                   /translation="MMELQHQRLMALAGQLQLESLISAAPALSQQAVDQEWSYMDFLEH
FT                   LLHEEKLARHQRKQAMYTRMAAFPAVKTFEEYDFTFATGAPQKQLQSLRSLSFIERNEN
FT                   IVLLGPSGVGKTHLAIAMGYEAVRAGIKVRFTTAADLLLQLSTAQRQGRYKTTLQRGVM
FT                   APRLLIIDEIGYLPFSQEEAKLFFQVIAKRYEKSAMILTSNLPFGQWDQTFAGDAALTS
FT                   AMLDRILHHSHVVQIKGESYRLRQKRKAGVIAEANPE"
     atgatggaac tgcaacatca acgactgatg gcgctcgccg ggcagttgca actggaaagc        60
     cttataagcg cagcgcctgc gctgtcacaa caggcagtag accaggaatg gagttatatg       120
     gacttcctgg agcatctgct tcatgaagaa aaactggcac gtcatcaacg taaacaggcg       180
     atgtataccc gaatggcagc cttcccggcg gtgaaaacgt tcgaagagta tgacttcaca       240
     ttcgccaccg gagcaccgca gaagcaactc cagtcgttac gctcactcag cttcatagaa       300
     cgtaatgaaa atatcgtatt actggggcca tcaggtgtgg ggaaaaccca tctggcaata       360
     gcgatgggct atgaagcagt ccgtgcaggt atcaaagttc gcttcacaac agcagcagat       420
     ctgttacttc agttatctac ggcacaacgt cagggccgtt ataaaacgac gcttcagcgt       480
     ggagtaatgg ccccccgcct gctcatcatt gatgaaatag gctatctgcc gttcagtcag       540
     gaagaagcaa agctgttctt ccaggtcatc gctaaacgtt acgaaaagag cgcaatgatc       600
     ctgacatcca atctgccgtt cgggcagtgg gatcaaacgt tcgccggtga tgcagcactg       660
     acctcagcga tgctggaccg tatcttacac cactcacatg tcgttcaaat caaaggagaa       720
     agctatcgac tcagacagaa acgaaaggcc ggggttatag cagaagctaa tcctgagtaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page