(data stored in ACNUC9543 zone)

EMBL: CP000308.PE349

CP000308.PE349       Location/Qualifiers
FT   CDS_pept        411425..412225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12318"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y479"
FT                   /protein_id="ABG12318.1"
FT                   /translation="MHILGGTVKLKTLALAAMIGLGTLPLALQAQAAEVPEGPHVVTSG
FT                   TASVEATPDIATIAIEVSVSAKDAADAKKQVDTRVAQYFDFLNKSGIEKKDVKAANIRT
FT                   QPEYDYQKSGEAVLKGYRAVRQVQVTLRQLDKLNDLLDGALKSGLNEIRAVELGVASPE
FT                   TYREQARKKAIENTITQAGALADGFKVKLGPVYSIRYHIANYQPMPVARMYKSAGAASD
FT                   TAVEQTYEQQTINFDDQVDVVFELQTGANPASIAATANKTVAAQ"
     atgcatatct taggaggcac cgtgaagttg aagacattgg ctttggccgc aatgatagga        60
     ttagggacgt tacctttggc gctgcaagct caagcggccg aagtgccaga agggccgcat       120
     gttgtcacct caggtaccgc cagcgttgag gcaaccccag atatcgcgac tatcgcaatt       180
     gaagtcagtg tatctgccaa agatgctgca gatgccaaaa agcaggtcga tacccgcgtc       240
     gcgcaatact ttgatttcct aaataaaagt ggcattgaaa agaaagatgt caaggccgct       300
     aatattcgta cccagcctga atatgactac cagaaaagcg gtgaagccgt attgaaaggt       360
     taccgtgctg tgcgtcaggt tcaggtgaca ttgcgccagt tggataaatt aaatgatttg       420
     ctggatggtg cgttgaaatc gggtctgaat gagatccgtg ccgttgagtt gggtgttgcc       480
     agcccagaaa cctaccgtga gcaggcgcgt aaaaaagcca ttgagaatac gattacgcag       540
     gccggcgcac tggccgatgg atttaaagtt aaattaggcc cggtttatag cattcgttac       600
     catatagcga attaccagcc aatgccggta gctcgaatgt ataaaagtgc tggagcggca       660
     tccgacacgg cggtggagca aacctacgaa caacagacca tcaattttga tgatcaggtt       720
     gatgtggtct ttgagctgca aacgggagcc aacccggcat cgatcgcagc tactgccaat       780
     aaaacagttg ctgctcagta a                                                 801
//

If you have problems or comments...

PBIL Back to PBIL home page