(data stored in ACNUC9543 zone)

EMBL: CP000308.PE35

CP000308.PE35        Location/Qualifiers
FT   CDS_pept        51575..51985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0035"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12004"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NM01"
FT                   /protein_id="ABG12004.1"
FT                   /translation="MSDINKQINHANDSHFFCHSMTLNMTGSSLVVEKNPVGNFLKFAM
FT                   NFPNLLLLFSDGTLIKQVERELKTHLICNEFVKNKSKIVTVYITLGNDALLLIYYSNRV
FT                   FYKKSYIKCGDIACMNYTVNEGYLTTEIILWR"
     atgagtgaca tcaataaaca aattaaccac gccaatgata gccacttttt ttgtcatagc        60
     atgacattaa atatgactgg atcctcgctt gttgtcgaaa aaaatcctgt aggaaatttc       120
     cttaaatttg cgatgaattt tcctaattta ttgctgttgt tttctgatgg cactttaatt       180
     aagcaagtgg aacgcgaatt aaaaacacat cttatttgta atgagtttgt taaaaataaa       240
     tccaaaatag tcactgtgta tatcactttg ggaaatgatg ctctgctatt aatatattat       300
     tctaaccgag tattttataa aaaatcatat atcaaatgcg gcgatatcgc gtgtatgaac       360
     tatacggtaa atgaggggta tttaactacg gagattattt tgtggcgtta a                411
//

If you have problems or comments...

PBIL Back to PBIL home page