(data stored in ACNUC9543 zone)

EMBL: CP000308.PE355

CP000308.PE355       Location/Qualifiers
FT   CDS_pept        417581..418159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12324"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB48"
FT                   /protein_id="ABG12324.1"
FT                   /translation="MSIENTLPTYPSLALALSQQAVALTPAEMHGLISGMLCGGSKDNG
FT                   WQTLVHDLTNEGVAFPQALSLPLQQLHEATQEALENEGFMFQLLIPEGEDVTVFDRADA
FT                   LSGWVNHFLLGLGMLQPKLAQVKDEVGEAIDDLRNIAQLGYDEDEDQEELAQSLEEVVE
FT                   YVRVAAILCHIEFTQQKPTAPEMHKPTLH"
     atgtctatag agaatacatt accaacttac ccatcacttg ccttggcact cagccagcaa        60
     gcagtagcat taaccccggc tgagatgcat gggttgatca gcggaatgct ctgtggtggc       120
     agtaaagaca acggctggca gacgctggta catgacttga ccaatgaggg agttgctttt       180
     ccacaagccc tgagtctgcc gttacaacag ttacatgaag caacacaaga agcgctggag       240
     aatgaaggtt ttatgttcca gttgcttatc cctgaaggcg aagatgttac tgtttttgat       300
     cgtgcagatg cgttatcagg ttgggtaaat catttcctct tggggttagg gatgttgcag       360
     ccgaagttgg cacaggtgaa agatgaagtg ggtgaagcca ttgacgactt gcgtaatatc       420
     gctcaattgg gatatgacga agatgaagat caagaagaac tggcgcaatc attagaagaa       480
     gttgtcgagt atgtgcgtgt tgcggccatt ttgtgccata tcgaatttac ccagcagaaa       540
     cctaccgccc ctgaaatgca taaaccgaca ctgcattga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page