(data stored in ACNUC9543 zone)

EMBL: CP000308.PE36

CP000308.PE36        Location/Qualifiers
FT   CDS_pept        complement(52137..52655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0036"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12005"
FT                   /db_xref="InterPro:IPR008514"
FT                   /db_xref="InterPro:IPR036624"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUY2"
FT                   /protein_id="ABG12005.1"
FT                   /translation="MPTPAYISITGKTQGNITAGAFTAESVGNIYVQGHEDEMLVQEFE
FT                   HIVTVPTDPQSGQPSGQRAHKPLRFTVAYNKAVPLLYNALASGEMLPTVELKWYRTSIE
FT                   GKQEHFFTTKLEDATIIDIDCKMPHCQDSTKAEFTQLVRVSLAYRKINWDHTTAGTSGA
FT                   DDWRAPIEA"
     atgccaactc cagcttatat ctctatcaca gggaaaacgc agggcaatat taccgcaggt        60
     gctttcacag ctgaatccgt cggtaatatc tatgttcaag gtcatgaaga cgaaatgttg       120
     gtacaggagt ttgagcacat tgtgacggtg cctaccgatc ctcaatccgg ccagccttcc       180
     ggccaacgtg cgcacaaacc attgcgtttc actgttgcgt acaacaaagc cgttccattg       240
     ctgtataacg cattagcctc tggtgaaatg ctgccaacag tggaattgaa gtggtaccgc       300
     acctcgattg aaggcaaaca agagcatttc ttcacgacta aactggaaga tgccaccatt       360
     atcgacattg attgtaaaat gccgcattgt caggattcca ccaaggctga gtttactcaa       420
     ttagtccgtg tatcactggc ataccgcaag attaactggg atcacaccac cgcgggcacc       480
     tctggtgctg atgactggcg tgcgccgatc gaagcgtaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page