(data stored in ACNUC9543 zone)

EMBL: CP000308.PE360

CP000308.PE360       Location/Qualifiers
FT   CDS_pept        424087..424473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0361"
FT                   /product="glycine cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12329"
FT                   /db_xref="GOA:Q1CB43"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q1CB43"
FT                   /protein_id="ABG12329.1"
FT                   /translation="MSNVPTELKYALSHEWVRADGDGVYSVGITEHAQELLGDMVFVDL
FT                   PEVGSDVSAGSDCAVAESVKAASDIYAPISGEIVAVNTELENSPELVNSAPYTDGWLFS
FT                   IKAADESELDNLLDADAYLAAIEE"
     atgagtaatg taccaacaga attgaaatat gccttatctc atgaatgggt tcgtgctgac        60
     ggcgatggtg tgtatagcgt cgggatcact gaacatgcgc aagagctgct gggtgatatg       120
     gtattcgtcg atctgccaga ggtgggcagc gatgtttcgg ccggtagcga ttgtgcggtt       180
     gccgaatcgg tgaaagccgc ttccgatatt tacgcgccta tcagcggtga aatcgttgca       240
     gttaatactg agttggaaaa ctcgccagaa ttggttaaca gcgcgcctta taccgatggt       300
     tggttgttca gtattaaagc cgctgatgag tccgaactgg acaatctgtt ggatgctgat       360
     gcttacctcg cggcgattga agagtaa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page