(data stored in ACNUC9543 zone)

EMBL: CP000308.PE362

CP000308.PE362       Location/Qualifiers
FT   CDS_pept        427942..428379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12331"
FT                   /db_xref="InterPro:IPR024311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQ33"
FT                   /protein_id="ABG12331.1"
FT                   /translation="MINNRFIGSWSLISQHFILPDNSIHYPMGQNMLGRINYEKQGTMA
FT                   AQLYRGDRAKFTTEDWLQGSDSEIKNAFLTALTYFGRYHIDEEQGIVTHTVEGCLFPNW
FT                   VGNQQIRHYQFEEDRLTLRTPPLQMNNSSLVGVLIWQKVKK"
     atgataaata atcgattcat cggcagttgg tcattgattt ctcagcattt tattttaccg        60
     gataacagta tccactaccc gatgggacaa aacatgttgg ggcgtattaa ttatgaaaaa       120
     cagggcacaa tggcggcaca actttatcgt ggtgaccggg ccaaatttac tacggaagac       180
     tggttacagg gcagtgatag cgaaattaaa aatgcctttc ttaccgccct gacttacttt       240
     ggccgctatc atattgatga ggaacagggc atcgtgaccc atactgttga aggctgcttg       300
     ttccctaact gggttggtaa ccagcagatt cgacattatc aatttgaaga agatcgttta       360
     acgttacgca caccgccatt gcaaatgaat aattcatcgc tggtgggggt attaatttgg       420
     caaaaagtga aaaaatag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page