(data stored in ACNUC9543 zone)

EMBL: CP000308.PE363

CP000308.PE363       Location/Qualifiers
FT   CDS_pept        428751..428876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12332"
FT                   /db_xref="GOA:A0A0H2Y568"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y568"
FT                   /protein_id="ABG12332.1"
FT                   /translation="MCWCILIYIIIRIHQLIFLWFYFIGIFSGFLSSNDSFIHDK"
     ttgtgctggt gtattttaat ttacattatc atacgtattc accagttgat atttttatgg        60
     ttttatttta ttgggatctt cagcggtttt ttgtccagta acgacagttt tatccatgat       120
     aaatga                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page