(data stored in ACNUC9543 zone)

EMBL: CP000308.PE365

CP000308.PE365       Location/Qualifiers
FT   CDS_pept        429625..431565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0366"
FT                   /product="putative surface protein"
FT                   /note="putative partial protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12334"
FT                   /db_xref="GOA:A0A0H2Y490"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y490"
FT                   /protein_id="ABG12334.1"
FT                   /translation="MDGPSVGPITSPNCNTPSIGIINTNAGQLFVGGTGAAVSGTLGPT
FT                   FWTGTFATPVGTSNTATAYGMVVQSGGAYITGNTYVQGGLFLNGQKATNLAPATISSTS
FT                   TDAVVGSQLYNLVQDGTRYFHANSVNPTDSLASGLETIAVGPATVVSGDNGVGIGNTAL
FT                   VGAAATGGIAIGFGTQVTAAGATAIGSAAQAQGAQSLALGAGAVTSQANSIALGAASIN
FT                   TVGAQSSYSAYALTAPQASVGELGIGTALGNRKITGVAAGSASSDAVNVAQLTAVGDQV
FT                   QQNTANITSLGGRVTTIEGSMASIANGGGVKYFHANSTQPDSVASGTNSVAIGPASLAS
FT                   GNAALASGAGAVAIGDGAAASADGSVAIGQGSGDNGRGVENYIGKYSNASNTSSGTVSV
FT                   GNTATGETRTVSNVADGLQATDAVNLRQLDGIAASIVVVENNVSGLQNGTDGMFQVNNS
FT                   SGLAKPSATGANSATGGAGSVASGNNSTAFGSGAKATAANSAALGANSVADRANSVSVG
FT                   SVGNERQITNVAPATQGTDAVNFDQLKSISNQTNAYTNQRYSELKQDLRKQNSVLSAGI
FT                   ASAMSMASLTQPYTSGSSMTTIGAASYRGQSALSLGVSSISDSGRWVSKLQASSNTQGD
FT                   FGIGVGVGYQW"
     atggatgggc cgtcggtggg gcctataact agtccgaatt gtaatactcc atctattggg        60
     attattaata caaatgcggg gcagctattt gttggtggaa cgggggctgc ggtatcggga       120
     acattaggcc ctactttttg gacagggaca tttgctacac cggtcggcac cagtaatacc       180
     gcaactgcat acggtatggt cgttcaaagc ggtggtgcgt acatcacggg taatacttac       240
     gtacaaggtg ggttattctt gaatgggcaa aaagcgacca atcttgcccc tgcgacgatt       300
     tcatctacct ctaccgatgc ggtagttggt agccagcttt ataatctggt ccaagatgga       360
     acccgctatt tccatgctaa ctcagtgaat ccaacagact cactggcctc tggcctggaa       420
     accattgctg tcgggccagc gacagtggtc agtggagata acggtgttgg cattggtaac       480
     accgcccttg tcggggcggc agcaacgggg ggaattgcaa taggtttcgg tactcaggtg       540
     acagctgccg gggctacggc catcggttcc gcagcgcagg ctcaaggggc gcaatctctg       600
     gcgttaggcg cgggggcggt gaccagccag gcaaacagta tcgcgttggg ggctgcttcg       660
     atcaatacgg tcggcgctca gagcagttac agtgcttatg cactaacggc tccgcaggca       720
     tcggtggggg agttagggat tggcaccgca ttgggtaatc gtaagattac cggtgtcgca       780
     gctggatcgg cgagttctga tgcggtcaat gttgctcagt tgactgctgt tggtgatcag       840
     gtgcagcaga ataccgcgaa catcaccagc ctgggtggcc gggttaccac cattgagggg       900
     agcatggcca gcatcgccaa tggtggcggt gtgaagtatt tccatgccaa ctcgactcag       960
     cctgactcgg tagccagtgg taccaattcg gtggccatcg ggcctgcttc tctggcttcg      1020
     ggtaatgctg ctttggcttc gggggcaggg gcggtggcga taggggatgg tgctgccgcc      1080
     agcgcggacg gcagtgttgc cattggtcag ggatctggtg ataacgggcg tggcgtagag      1140
     aactacatcg gtaagtattc caatgcgagt aacaccagct cgggtaccgt atcagtgggt      1200
     aatactgcta ctggagaaac ccggacggtc agcaatgttg ccgatgggct gcaggccacc      1260
     gatgcggtca atttgcgaca actcgatggt attgctgcct ctatcgtcgt cgtcgaaaac      1320
     aacgtttctg ggctccagaa tggtaccgat ggtatgtttc aggtgaataa tagtagcggt      1380
     cttgccaagc catccgcaac cggtgctaat tcagcaactg gtggtgccgg ttctgtggct      1440
     tccggcaata acagtaccgc gtttggctca ggtgctaaag caacagcggc aaacagtgca      1500
     gccttggggg ctaactcagt agctgatcgg gcaaacagtg tttcggtagg ctctgttggt      1560
     aatgaacggc agatcaccaa cgtcgccccc gcaactcagg gaaccgacgc ggtgaacttc      1620
     gatcaactta agagcatttc caatcaaact aatgcttaca cgaaccaacg ttattccgag      1680
     ctgaagcagg atctgaggaa acaaaatagc gtgttgagtg cagggatagc tagcgcaatg      1740
     tctatggcga gcttgacaca accatatact tcgggttcca gcatgaccac tatcggcgcg      1800
     gccagttacc gtggtcaatc ggctctgtcg ctaggggtat cgagtatttc tgacagcggg      1860
     agatgggtca gcaaactaca ggcatcctct aacactcaag gtgattttgg gattggtgtc      1920
     ggtgtagggt atcagtggta a                                                1941
//

If you have problems or comments...

PBIL Back to PBIL home page