(data stored in ACNUC9543 zone)

EMBL: CP000308.PE37

CP000308.PE37        Location/Qualifiers
FT   CDS_pept        53179..53676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12006"
FT                   /db_xref="InterPro:IPR008312"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NY17"
FT                   /protein_id="ABG12006.1"
FT                   /translation="MSKNKQSSVAPKERINIKYVPNTGDQVAEIELPLNLLVVGDLKGV
FT                   REETSIEERQVVSVNKNNFNSVMNEANISLSFNVPNRLEGDGEEDMPVALSIKGLDDFS
FT                   PDNVAKKVPELKKILELREALVALKGPLGNIPAFRSRLQDLLGNEDMREQLLKELDILN
FT                   QK"
     atgagtaaaa ataagcaaag cagtgttgcc ccaaaagaaa ggattaacat caagtatgtg        60
     ccgaatactg gcgaccaggt tgcagaaatt gaattaccgc tgaatctgct ggttgtgggt       120
     gatcttaaag gcgtgcgtga agagacttca attgaagagc gtcaggttgt ttcggtcaat       180
     aagaataact tcaactcagt catgaacgaa gcaaatatca gtctgagttt caatgtgcct       240
     aatcgccttg aaggtgatgg ggaagaagac atgccggtcg ccttgtcgat caagggtctt       300
     gatgatttct cgcctgacaa tgtggcgaaa aaagttccag agctcaaaaa aattctggaa       360
     ctacgggaag cgttagtggc attgaaaggg ccattgggga atatcccagc tttccgctct       420
     cgtctacagg atttgcttgg caatgaagat atgcgcgagc agttgctgaa agaattggac       480
     attcttaatc aaaaataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page