(data stored in ACNUC9543 zone)

EMBL: CP000308.PE370

CP000308.PE370       Location/Qualifiers
FT   CDS_pept        435812..436078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0371"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12339"
FT                   /db_xref="InterPro:IPR005631"
FT                   /db_xref="InterPro:IPR036714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWZ7"
FT                   /protein_id="ABG12339.1"
FT                   /translation="MEIDNKARIHWACRRGMRELDISIMPFFEYEYDSLSDNEKQAFIR
FT                   LLECDDPDLFNWLMNHGEPQDSELYQMVKLIQSRNKARGPVAM"
     atggaaattg ataataaagc ccgtattcac tgggcatgcc gccgtggtat gcgtgaactt        60
     gatatctcca tcatgccgtt ttttgaatat gaatatgata gcttgagcga taacgagaaa       120
     caggcattta tccgcttgct tgagtgtgat gacccagatt tattcaactg gctgatgaac       180
     cacggggagc cgcaggatag cgagctatat cagatggtca aactgattca atcacgaaat       240
     aaagcccgtg gcccagtggc gatgtaa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page