(data stored in ACNUC9543 zone)

EMBL: CP000308.PE38

CP000308.PE38        Location/Qualifiers
FT   CDS_pept        53744..55225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12007"
FT                   /db_xref="InterPro:IPR010269"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NMQ7"
FT                   /protein_id="ABG12007.1"
FT                   /translation="MPLHEENTVLAAEPASATFLLDEIMSQTRMAPGNDGYDIAKQGVA
FT                   AFISSILDTGTNEEPINKLLVDRMIIELDKKLSAQMDEILHANEFREIESSWRSLKLLV
FT                   DRTDFRENIKINIMHATKEELLEDFEFSPEIIQSGFYKHVYSSGYGQFGGEPTAAIIGN
FT                   YAFNNSSPDMKLLQYVSAVGAMAHAPFLSSVAPDFFGISSFTELPAIKDLKSVFEGPAH
FT                   TKWRALRESEDSRYLGLTTPRFLLRLPYSTVENPIKNFNYYEDVSRNHEHFLWGNTAFL
FT                   LASCLTDSFAKYRWCPNIIGPQSGGTVHDLPVHLYEAMGQIQAKIPTEVLITDRREFEL
FT                   AEEGFITLTMRKGSDNAAFFSANSVQKPKVFPNTREGKMAETNYKLGTQLPYMFVINRL
FT                   AHYIKVLQREQIGSWKERQDLERELNIWLKQYIADQENPPTDVRSRRPLRSAQIQVLDV
FT                   EGDPGWYQVAMQVRPHFKYMGASFELSLVGRLDKE"
     atgcctttac atgaagaaaa taccgtttta gcggcagaac ctgccagtgc aacattcttg        60
     ctcgacgaaa tcatgtcaca aacccgtatg gcaccgggaa acgatggtta cgatatcgct       120
     aaacagggtg tggccgcttt tattagcagt attctggata ccggaaccaa cgaagagccg       180
     attaacaagc tgttagttga ccgcatgatc atcgaactcg acaaaaagtt gagtgctcag       240
     atggacgaga tcctacatgc taacgaattc cgtgaaatag aatcttcatg gcgctcattg       300
     aagctgttgg tggatcggac cgatttccgt gaaaacatca aaatcaatat catgcatgca       360
     acgaaagaag agttgctgga agattttgag ttctcgccag aaattattca gtcaggcttc       420
     tacaaacacg tttattcctc agggtacggc caattcggtg gtgaacccac tgccgcgatc       480
     attggtaact acgcgttcaa caatagctca cctgacatga agctcttgca atacgtaagt       540
     gctgttggcg cgatggcaca tgcccccttc ttatccagtg tggcccctga tttctttggc       600
     atcagcagct tcactgagtt acccgcgatt aaagatctga aatctgtatt tgaagggccg       660
     gctcacacca aatggcgtgc tctgcgtgag tctgaagatt cacgttatct tggtttgacc       720
     actcctcgtt tcctgttgcg cttaccttac tcgaccgttg aaaaccccat taaaaacttc       780
     aactactacg aggatgtcag ccggaatcac gagcatttct tgtggggcaa caccgcattc       840
     ctgctagcgt cctgcctgac cgacagcttc gccaagtacc gttggtgccc gaatattatt       900
     gggccgcaaa gtggcggcac ggttcacgat ctcccggttc atctctatga agcgatgggg       960
     cagattcagg ccaaaatccc aaccgaagtt ctgatcactg accgtcgtga gtttgaactg      1020
     gcggaagagg gctttatcac cctgaccatg cgtaaaggca gtgataacgc cgcattcttc      1080
     tcggcgaatt cggtgcaaaa accaaaagtc ttcccgaata cccgcgaagg gaaaatggca      1140
     gaaaccaact acaagttggg cacgcaactg ccgtacatgt ttgtcatcaa ccgccttgcg      1200
     cactacatca aagtgctcca gcgcgagcag attggttcat ggaaagaacg acaggatctg      1260
     gagcgcgagc tcaatatctg gctcaagcag tacattgccg atcaagaaaa cccaccaacg      1320
     gatgttcgta gccgtcgtcc tctgcgttca gcgcaaatcc aggtactgga tgttgaaggt      1380
     gatccgggct ggtaccaggt tgcgatgcag gttcgcccgc atttcaaata catgggggcg      1440
     agcttcgagc tgtcactggt tggccgtttg gataaggaat aa                         1482
//

If you have problems or comments...

PBIL Back to PBIL home page