(data stored in ACNUC9543 zone)

EMBL: CP000308.PE386

CP000308.PE386       Location/Qualifiers
FT   CDS_pept        complement(451084..451209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0387"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12355"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y322"
FT                   /protein_id="ABG12355.1"
FT                   /translation="MVGWTGASKDAPGSLLTGLLTPFSPPPKGISSSWWWDKAIN"
     atggtgggct ggacgggggc atcgaaagat gcgccgggtt ctctgttgac cggtctgcta        60
     accccgttca gtccaccacc caaagggatt agcagctctt ggtggtggga taaagccatc       120
     aactga                                                                  126
//

If you have problems or comments...

PBIL Back to PBIL home page