(data stored in ACNUC9543 zone)

EMBL: CP000308.PE392

CP000308.PE392       Location/Qualifiers
FT   CDS_pept        complement(455944..456603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0393"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12361"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4B4"
FT                   /protein_id="ABG12361.1"
FT                   /translation="MSALVHYSECIPFNVSSMMAKSWRSSRSYSALTAGFFSIRATTCS
FT                   WDRLGGWRLLSKSQLLHSFSGFAFLFPRHISRFLHHNMQNNNLPVYLCHKNDAVPAFRL
FT                   IKTQLKHIFVVMHRDSINHLNTVALHTFSQANKIGLQADGLGKKLGDDIIIVIFNGVVH
FT                   RLKNNRNVIFLRLRMYQKERPDITQYCRGVYPPRSKGGAVDTMSLRIFPLGATTGQ"
     atgagtgcgc tggtgcatta ttcggaatgt attcccttta acgtttcatc aatgatggcg        60
     aaatcctggc gctccagccg ctcatattct gccctcactg ccggtttctt tagcattcgg       120
     gcgaccactt gttcatggga caggcttggt ggttggcgtt tattatccaa atcgcaactc       180
     cttcattcgt ttagcggctt tgcctttctc tttccacggc atataagccg ttttttgcac       240
     cacaatatgc aaaataacaa tctgccagtc tatttgtgcc ataaaaatga cgcggttcca       300
     gcctttcggc tcataaaaac acagctcaaa cacatcttcg tggtaatgca tcgggacagc       360
     atcaaccatc ttaataccgt agcgcttcat acgtttagcc aggctaataa aattggcctg       420
     caagctgatg ggttgggcaa gaagctgggt gatgacatca tcatcgtaat attcaatggt       480
     gtagttcata ggctaaaaaa taacagaaac gttattttcc tccggctgcg gatgtatcaa       540
     aaggaacgcc ccgacatcac tcaatactgc cggggcgttt atccaccacg gagcaagggt       600
     ggcgcggtgg atacaatgag tctacgaata ttcccgttgg gtgcaactac tggacaatag       660
//

If you have problems or comments...

PBIL Back to PBIL home page