(data stored in ACNUC9543 zone)

EMBL: CP000308.PE395

CP000308.PE395       Location/Qualifiers
FT   CDS_pept        complement(456982..457314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0396"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12364"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQE4"
FT                   /protein_id="ABG12364.1"
FT                   /translation="MEGWVKANGFHWPLPLGAALVPEQRQAEESWGGFAGKETALAFIA
FT                   GMAITLARNNPQYRRGVKMNKTAIARVATQAMFNAGFSGEMVTEKQMSNLISEALLVSL
FT                   PGADNP"
     gtggaaggct gggttaaggc gaatggattt cactggccgc taccactggg cgctgcactg        60
     gtgccggagc agcggcaagc agaagagagc tggggtggtt ttgccggtaa agaaaccgcg       120
     ctggcgttta ttgccggtat ggctatcacg ttagccagga acaacccgca gtaccggcgc       180
     ggcgtcaaaa tgaataaaac cgccattgcc cgggtggcga ctcaggctat gttcaacgcg       240
     ggattcagcg gggaaatggt gaccgaaaag caaatgagta acttgatcag cgaggcgctg       300
     cttgtttctc tgcccggggc cgataatcct tag                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page