(data stored in ACNUC9543 zone)

EMBL: CP000308.PE396

CP000308.PE396       Location/Qualifiers
FT   CDS_pept        complement(457320..457556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0397"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12365"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NZE7"
FT                   /protein_id="ABG12365.1"
FT                   /translation="MNCYDYVGFNRTEIEQLLQINLRDSDEEYQNILKDKLPKWLTPFL
FT                   SRINITIKETAALIVGVMPYSIQIDDIGMVIIN"
     atgaattgtt atgattacgt cggatttaac cggactgaaa tagaacagct tttgcagatt        60
     aacctgcgtg acagtgacga agaatatcaa aatattctta aagataaatt accaaaatgg       120
     ttaacgccat ttctatccag aattaatatc acaataaaag aaacggctgc actgattgtt       180
     ggggtgatgc cttattctat tcaaattgat gatataggaa tggtaataat taattag          237
//

If you have problems or comments...

PBIL Back to PBIL home page