(data stored in ACNUC9543 zone)

EMBL: CP000308.PE40

CP000308.PE40        Location/Qualifiers
FT   CDS_pept        55672..56898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12009"
FT                   /db_xref="InterPro:IPR010272"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQ47"
FT                   /protein_id="ABG12009.1"
FT                   /translation="MSFEKYFRDELDYLRQLGRDAAIERPHLAAFLSEQGSDPDVERLL
FT                   EGFAFLTGNLREKIDDQFPELTHGLLNMLWPNYLRPIPSMTIIEYTPDESVVTEATLVK
FT                   RGSQVMSIPIAQNGQRSAFINSNAHAGPQCTFTLCRDVWLFPMSIREISANSSNEQGIL
FT                   SIHFAAKAELNLQDLQLDKLRFYLGEDNYTSTQLYFWINHYFERAELVVNGITIPMPDF
FT                   DFNPVGFERDDALLPYPKNAYMGYRILQEYFCFPEGFLFFDVNGVVDFPPHLNASEFSL
FT                   NLYFSQALPPEVKVRSTTLRMNCTPAVNLFQHDSEAIDLDGTQTEYPLCVSYHNPDHYD
FT                   IFSVDRVDSWLSEKGVPKGRGRALNPKTWTSALLLFYLSPVFCRTHSACFQANALCIVI
FT                   MDIFYNVTL"
     atgtcgttcg aaaagtattt cagggacgag ctggactacc tccggcaatt aggacgcgat        60
     gccgcaatag aacggcctca tctcgctgca tttttatctg agcaaggttc tgatccggat       120
     gttgaacgtt tgctggaagg ctttgctttt ctaacgggca acctgcgtga aaaaatcgat       180
     gatcaattcc ctgaattgac tcatggttta ctgaatatgt tgtggccgaa ctacttacgg       240
     ccaataccga gcatgaccat catcgagtac acaccggatg aaagtgtggt caccgaggcg       300
     acgctggtga aacggggtag ccaagtgatg agtatcccca tcgcacaaaa tggtcagcgc       360
     agcgcgttta tcaacagtaa tgctcatgcc gggccacaat gtacttttac gttgtgccgt       420
     gatgtgtggt tgttccccat gtccatccgg gagatctcgg cgaacagcag taacgaacaa       480
     ggcattttga gtattcactt tgccgccaaa gcggaattga acttacaaga cctgcaattg       540
     gataaattgc gcttttatct gggcgaagac aactacacca gcacacaact ctatttctgg       600
     attaaccact atttcgaacg cgctgaactg gttgtcaacg ggataaccat cccgatgcct       660
     gattttgact ttaacccagt gggctttgaa cgcgatgatg ccctcttgcc gtacccgaaa       720
     aacgcctata tgggttaccg gatcctgcaa gaatattttt gcttccccga aggctttttg       780
     ttctttgatg tcaatggtgt ggtcgatttt ccgccgcact tgaatgccag tgaattctct       840
     ctgaatttgt atttctctca ggcattgccg cctgaagtga aagtccgctc caccacactg       900
     cggatgaatt gcacacctgc ggtgaacctg ttccaacatg acagtgaagc gattgatctt       960
     gatggaaccc agacggaata tccgctctgt gtcagctacc ataatccgga tcactacgac      1020
     atcttttcag ttgatcgggt tgacagttgg ctcagtgaaa aaggtgttcc taaggggcgc      1080
     ggccgtgcac tgaaccccaa aacttggaca tctgctttac tgcttttcta cctgagtccg      1140
     gtattctgcc ggactcattc cgcctgtttt caggctaatg cgctctgtat tgtaataatg      1200
     gatatattct acaatgtcac gctttaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page