(data stored in ACNUC9543 zone)

EMBL: CP000308.PE401

CP000308.PE401       Location/Qualifiers
FT   CDS_pept        462862..465057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0402"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12370"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y337"
FT                   /protein_id="ABG12370.1"
FT                   /translation="MKINSKLWMGLLMGMLGMAVPPSQASSDNTGCVWGKYCPLSGVPF
FT                   LDVYNDTRVNMMLLVGEPKNFILPRLTMPADITRSRNYHFGEFYYDEMSFPKREKSLTD
FT                   ENNDSPSEETPFDKMAKTLGINSASFKGTNARYREARHISNNPASVEQFFTALLADSSL
FT                   TADDRHNLALWRSNIFHNVDAPVDGGITPPPFNIVPGSHVDAFSDYLHGANAFYRGDYP
FT                   EATALFSALQKSSQAWVAETATYMLFRVALNESSTNASDKYGMFETKNINQDAARQALD
FT                   YSRAYLVAYPQGIYAESIQGLERRIYWYLSDWQQLARLYEETLLAAPNAEALWDTVSEV
FT                   DAKFISKDAFGGEPFISDMQAPLLTFTQTLRWLRLGGRQSGSELEVTQEKLASYKPMFV
FT                   DADRLPLWQYLQTAWLYYHEQDYAGVVATVSAVDSLPATDIVTFSQQILYGDALVAQQQ
FT                   WSQAEAHWRKLLGLVQSPQQQQYLQLKLAAVLVNSDQIEAIFTADSPIKNLRYRSLILK
FT                   TKAQKALLQQQVISGANDEEKTIALHTLLLRDLMLGDYQGYEQDKQLSPHIQQSVDQKS
FT                   FADVDLAAFDWQGDNVEQGYACAALDGTVKALVKNKTDGHALNCLGEFFRVTDININTY
FT                   QEGEGNEVLNVAVHAHETVITQPNRFDYYQHVINDPKAEPEDKSYALYRAVMCYAPSGY
FT                   NQCGGEDVDIATRKRWFSSLKTQYKGSRWAERLNYYW"
     atgaaaataa acagtaagtt atggatgggc ctcctaatgg gcatgctagg tatggcggta        60
     cctccatcac aggcttcttc tgataatact ggctgtgtgt ggggaaaata ttgcccgctc       120
     agtggtgtac cctttttgga tgtttacaat gatactcggg ttaatatgat gttattggtt       180
     ggagaaccaa aaaatttcat attgccacgt ttaacgatgc cagcggatat tacccgtagt       240
     aggaattacc attttggtga gttttattat gatgaaatga gttttccgaa gcgggaaaaa       300
     agtcttacag atgagaataa tgatagccct tcggaagaaa cgccatttga taagatggca       360
     aagacgctag gcatcaattc ggcttcgttt aagggaacca atgcccgata tagagaagca       420
     cggcatatct ccaataatcc cgcatcagtt gagcaatttt ttaccgcttt actggcagac       480
     tcgtccttaa ctgccgacga tcgacataat ttagccctct ggcgatccaa tatttttcat       540
     aatgtcgatg caccggtcga tggtggaatt acaccgccac cttttaacat tgtgccaggc       600
     tcacatgttg atgcttttag cgattatctt catggcgcca atgcatttta tcggggcgat       660
     tacccagagg ccaccgcttt attttctgcc ctccaaaaga gttctcaagc atgggtcgca       720
     gaaacagcga cttatatgtt gttccgagtt gcgctcaatg agagcagtac aaatgcgtcg       780
     gataaatatg gcatgtttga aactaaaaat atcaatcagg atgccgcccg tcaggcattg       840
     gattattctc gggcctattt agttgcttat ccccaaggca tttacgcaga gtcgattcag       900
     gggttggagc gccgtattta ctggtacctc tctgattggc aacaactggc gcggctgtat       960
     gaagagacat tactggcagc accgaatgct gaagctttgt gggataccgt atcagaagtt      1020
     gatgctaaat ttatcagcaa agatgccttt ggtggcgagc cctttatcag cgatatgcaa      1080
     gcacctttac tgaccttcac gcaaacatta cgttggttgc gattaggggg gcgccagagt      1140
     ggctctgagt tggaggttac gcaggagaaa ctggcaagtt ataaaccgat gtttgtcgat      1200
     gcggataggc tccccctttg gcagtatcta cagacggcct ggctctatta tcatgagcaa      1260
     gattatgccg gtgtcgtcgc cactgtctcg gctgtcgact ctctgccagc cactgacatt      1320
     gtgaccttca gtcaacagat tctatatggt gatgcattgg tggctcaaca acaatggtca      1380
     caggccgaag cacattggcg caagctgctg ggcctggtgc aatcgccgca acaacagcaa      1440
     tatctgcaac tcaaactcgc cgcggttctg gtgaacagtg atcaaattga agccatattt      1500
     accgcagata gcccaatcaa aaacctgcgt tatcgttctc tgatactcaa aacaaaagct      1560
     caaaaagcac ttttacaaca gcaagttatt tctggtgcta atgatgagga aaaaaccatt      1620
     gctctgcaca cgctattact gcgggatctt atgcttggtg attatcaggg ttatgagcag      1680
     gataaacagt taagccctca tattcagcaa tccgtcgatc aaaaaagctt tgccgatgta      1740
     gacctggcgg cgttcgattg gcagggcgat aatgtggagc agggctatgc ctgtgctgcg      1800
     ttagatggga cggtaaaagc attggttaaa aataaaacgg atggtcatgc cctcaactgc      1860
     ttgggagaat tcttccgtgt aactgacatc aatatcaata cttatcagga aggggagggc      1920
     aatgaggtgc tgaatgtcgc agtccatgca catgaaacag tgataactca gcccaatcgt      1980
     ttcgattatt atcaacacgt tatcaacgac ccgaaggcgg agccagaaga taaaagctat      2040
     gcgctttacc gggctgttat gtgctatgcc ccatcgggct ataatcaatg tgggggtgag      2100
     gatgtcgata ttgcaacacg taagcgttgg tttagctcat tgaaaactca gtataaaggt      2160
     agccgatggg cagaacggct caactattac tggtaa                                2196
//

If you have problems or comments...

PBIL Back to PBIL home page