(data stored in ACNUC9543 zone)

EMBL: CP000308.PE403

CP000308.PE403       Location/Qualifiers
FT   CDS_pept        466399..467178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0404"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12372"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1P2K9"
FT                   /protein_id="ABG12372.1"
FT                   /translation="MKKVNLLVWIGLSLNLVLVLASWFFTVDYQELYGELGYRDRMLLD
FT                   AIAVLRYYFAVSLVLQILSVIFLDKANKLSFGLAIISCLGMLPLSIVFLIGYLFTYNDY
FT                   VYRGLKTFSLNETGKLDTYLNFATVRYFMLGAFATVAGVFMFFTDMPMSMLIIVVGVLN
FT                   MINGIRLGPRPVIALMGDNLVFTPALMSNTYIISIEHVDLVESKKGKFKIKLNLEGLEK
FT                   KITFQKNIMENDKDSSALEKILAKIEKNNGEKQHIFL"
     atgaaaaagg taaatttact ggtctggata ggtttatcac taaacttagt gcttgttttg        60
     gccagttggt ttttcactgt agactatcag gaactctatg gtgagttagg ctatagagat       120
     cggatgttgc ttgatgctat cgccgtattg agatactact ttgctgttag tcttgtattg       180
     caaatcctta gcgtgatttt tctagataaa gccaataaac tttcatttgg attggccatt       240
     atctcttgcc tgggtatgtt acccctcagt attgttttcc ttattggtta tctctttacc       300
     tataacgatt acgtttaccg tggtttaaag acgttttcat taaatgaaac gggtaagctt       360
     gatacatatc taaattttgc cactgttcgt tattttatgc taggtgcgtt tgcaactgta       420
     gcgggtgttt ttatgttttt cactgatatg ccaatgagta tgttaattat tgtcgtcggt       480
     gtgttgaata tgataaatgg tattcggttg gggcctcgcc ctgtgattgc cttaatgggg       540
     gataatctgg tatttacacc cgcgttgatg tcgaatactt atattatctc aattgagcac       600
     gttgacctgg tagaaagcaa aaaaggtaaa ttcaagatta aattaaattt agagggatta       660
     gagaaaaaaa taactttcca gaaaaatata atggaaaatg ataaagattc tagtgctctt       720
     gaaaaaatac ttgccaaaat tgaaaaaaat aacggtgaaa aacagcatat tttcttgtaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page