(data stored in ACNUC9543 zone)

EMBL: CP000308.PE404

CP000308.PE404       Location/Qualifiers
FT   CDS_pept        467395..467700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0405"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12373"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y3Y9"
FT                   /protein_id="ABG12373.1"
FT                   /translation="MPISEINRKIEVYMKGVICIGDKTTHGGQVLSGSGKMKFAGIGVA
FT                   RLNDPVSCPQHGNTFIIEAHPSFKDNGIPVAFHGHRCGCGCTLISSQKGATVIAMR"
     atgccaataa gtgaaattaa tagaaaaatt gaggtgtata tgaaaggcgt catctgtatt        60
     ggtgataaaa ccacgcatgg cgggcaagtg ctcagtgggt ctggcaaaat gaaatttgca       120
     ggtattggtg tggcgcgcct gaatgatccg gtctcttgcc cacagcatgg taataccttc       180
     attatagaag cacatccttc atttaaggat aacggcattc cagtggcttt ccatggtcat       240
     cgctgtggtt gtggctgcac cttgatcagc tctcagaagg gagcaacggt gatcgctatg       300
     cggtga                                                                  306
//

If you have problems or comments...

PBIL Back to PBIL home page