(data stored in ACNUC9543 zone)

EMBL: CP000308.PE408

CP000308.PE408       Location/Qualifiers
FT   CDS_pept        complement(470440..470958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0409"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12377"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NQI5"
FT                   /protein_id="ABG12377.1"
FT                   /translation="MKNKIFTAIVLLFSFSLSIQAIANKKNDKKIIINNLTLSSTWVRT
FT                   AISESIDSPSNTINKDDIKRMAAGKHIYIMDNKITIEGVCTFKYVIKKSSPLNYWHSDK
FT                   TVNLYKEEFLKNGFKLSENLAFISAEDPSNDCDSPYSQIAITDNVIFTVYNGHIVFYTN
FT                   SNNVNELAL"
     atgaaaaata aaatattcac agcaatagtg ctattatttt cctttagcct ttcaattcaa        60
     gccattgcca ataaaaaaaa cgataaaaaa atcatcatta ataacctaac actatcctca       120
     acatgggtgc gaacggccat atcagagtct atagacagcc cgagcaatac gataaataaa       180
     gacgatatca agaggatggc agcaggaaag cacatataca taatggataa taaaataacg       240
     atagagggag tctgtacctt taagtatgtt attaaaaaaa gcagtccttt aaattattgg       300
     catagtgata aaaccgttaa tttatataaa gaagagtttc taaaaaacgg ttttaagtta       360
     agcgaaaatt tagcttttat ttcagctgaa gatccgagta atgattgcga ctccccttac       420
     tctcaaatcg ccataactga taatgtgata tttactgttt ataatggtca tattgtattt       480
     tacacaaatt caaacaatgt taatgaattg gcattatga                              519
//

If you have problems or comments...

PBIL Back to PBIL home page