(data stored in ACNUC9543 zone)

EMBL: CP000308.PE412

CP000308.PE412       Location/Qualifiers
FT   CDS_pept        complement(476306..477406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0413"
FT                   /product="sugar transport ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12381"
FT                   /db_xref="GOA:A0A0E1NUD0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NUD0"
FT                   /protein_id="ABG12381.1"
FT                   /translation="MSSIRLRNVTKRFGKTETLHNINLDIEDGEFAVFVGPSGCGKSTL
FT                   LRMIAGLEEISDGEVLIDDEVINDVAPSHRGVAMVFQSYALYPHMTVAENMGYGLKVNK
FT                   VPKEQIRHQIEMVAKTLQLSHLLDRKPKQLSGGQRQRVAIGRAIVRNPKVFMFDEPLSN
FT                   LDAELRVEMRLHIAKLHQEMKTTMVYVTHDQVEAMTLADKIVVMNYGKIEQMGSPMSLY
FT                   YNPVNKFVAGFIGSPKMNFLPATVESWQPDSVTVAEGHSLTLALHTSPLQAGDPVTIGI
FT                   RPEHLSVADSTVQTLDFHCEVVERLGNNTYLFGQCHGHDGFKMLLAGDVHFRPYQKLNL
FT                   SFDAGYCMVFNADGLRINAEIPVPHE"
     atgtccagca ttagactgag aaacgtgacc aaacgttttg gcaaaaccga aacactccat        60
     aacatcaacc ttgatattga agatggggaa tttgctgtct tcgttggccc ttccggctgc       120
     gggaaatcaa cactactaag gatgattgcc gggcttgaag agataagtga tggtgaggtt       180
     ttgattgacg atgaggtgat caatgatgtc gctccctcac atcgtggcgt agcgatggtc       240
     ttccagtcct acgcgctcta cccacacatg acggtagccg aaaacatggg ctatggtttg       300
     aaagtcaata aggtgcctaa agagcagatc cgtcatcaaa tagagatggt ggctaaaacc       360
     ttacaactgt cccatttact cgacagaaaa ccaaaacaac tctccggtgg gcagcgtcag       420
     cgcgtcgcca ttggccgtgc cattgtgcgc aacccgaaag tgttcatgtt tgatgaaccg       480
     ctttccaacc ttgacgccga actccgtgtc gaaatgcgtc tgcacatcgc aaaacttcat       540
     caggaaatga agaccaccat ggtgtatgtc acccatgacc aagtggaagc gatgacatta       600
     gccgataaga ttgtggtgat gaactacggc aagattgagc aaatgggctc accaatgtcg       660
     ctctattaca acccggtgaa taaatttgtt gctggtttta tcggttcgcc aaagatgaat       720
     tttctgcccg cgaccgtgga aagctggcag cctgattccg tgaccgtcgc cgaaggccat       780
     agcctgacat tggcattgca cacctcacca ctacaggccg gtgatcccgt cactattggg       840
     atacgtccag aacatctcag cgtggctgat agcacagtgc aaacattaga ttttcattgc       900
     gaagtggtag aacgactggg gaataacacc tatctgtttg gtcagtgcca cggtcacgat       960
     ggcttcaaaa tgctgttagc aggagatgtc catttccgcc cttatcagaa gctaaatctg      1020
     agttttgatg ctggatattg catggtgttt aacgctgatg ggttacgcat aaatgcagag      1080
     attccggtgc ctcatgaata a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page