(data stored in ACNUC9543 zone)

EMBL: CP000308.PE413

CP000308.PE413       Location/Qualifiers
FT   CDS_pept        477769..479004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0414"
FT                   /product="putative sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12382"
FT                   /db_xref="GOA:A0A0E1NXJ7"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXJ7"
FT                   /protein_id="ABG12382.1"
FT                   /translation="MKINKITALVLTALAVTQFAGFAAHAATQQLTVWEDIKKSAGIKE
FT                   AIADFEKQHQVKVNVLEMPYAQQIEKLRLDGPAGIGPDVLVIPNDQLGGAVVQGLLTPL
FT                   SVDPTIVTTFTKPSIAAFTMDNALYGLPKAVETLVMIYNKDMLPTPLATLDEYAAFSKK
FT                   QRAENKYGLLAKFDQIYYSWGAIEPMGGYIFGKDANGSLKANDIGLNTPGAVEAVTYLK
FT                   TFYANGLFPIGTIGDNGLNAIDSLFTEKKAAAVINGPWAFQPYEAAGINFGVSPLPALP
FT                   NGKDMSSFLGVKGYVVSTWSKDKALAQQFIEFINQPQYVKTRYQVTKEIPALTAMIDDP
FT                   LIKNDEKASAVAIQASRASAMPGIPEMGEVWGPANSALELSVTGKQEPKVALDNAVKQI
FT                   NMQIEAMQASNQ"
     atgaaaatca ataaaatcac tgcgcttgtt ttaaccgcac tggcagtcac ccagtttgct        60
     ggtttcgctg cccacgctgc tacacagcaa ttaacagttt gggaagacat caaaaaatct       120
     gccggtatta aagaggctat cgctgatttt gaaaaacagc atcaggttaa ggtcaatgtg       180
     ctggaaatgc cttacgcaca acaaattgaa aaactccgcc ttgatggccc tgcaggtatc       240
     ggccctgatg tgttggtgat tcccaatgat cagttaggtg gtgcggtagt gcaaggtttg       300
     ctgacaccgc tcagcgttga tccaaccata gtcactactt ttactaaacc ttctatcgct       360
     gccttcacca tggataatgc cctctacggt ttaccgaaag ccgtggaaac gctggtgatg       420
     atctacaaca aagacatgct gccaacgccg ttagctacct tggatgagta cgccgcattc       480
     tctaagaaac aacgcgcaga aaataaatat ggtctgttgg cgaagttcga tcagatctat       540
     tacagctggg gagcgatcga gccaatgggc ggttacatct ttggtaaaga tgctaacggt       600
     agcttgaagg ctaacgatat cgggctaaat acaccagggg ctgttgaggc cgtaacctat       660
     ttgaaaacat tctatgctaa cggtctgttt ccaattggca ccatcggtga taacggcttg       720
     aatgctattg actcattatt cactgagaaa aaagcggctg cggtaattaa cgggccatgg       780
     gcattccaac cgtatgaagc cgctggtatt aactttggtg tgtcaccact gccagcattg       840
     ccgaacggca aagatatgag ctccttcctc ggtgtgaaag ggtatgtcgt ttctacctgg       900
     agcaaagata aggcactcgc ccagcagttc atcgaattta ttaaccaacc gcaatacgtg       960
     aaaacccgct atcaggtcac caaagagatc cccgcgttga cggccatgat tgacgatcca      1020
     ttgattaaaa atgatgaaaa agccagtgcg gtagccattc aggcaagccg tgcctctgcg      1080
     atgcctggta ttccagaaat gggcgaagtg tggggacctg ctaactcagc attagagcta      1140
     agcgtaacgg gcaaacagga gcctaaagtc gctctcgata acgccgttaa gcagatcaat      1200
     atgcaaatcg aggccatgca ggccagtaat cagtaa                                1236
//

If you have problems or comments...

PBIL Back to PBIL home page