(data stored in ACNUC9543 zone)

EMBL: CP000308.PE423

CP000308.PE423       Location/Qualifiers
FT   CDS_pept        492592..493674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0424"
FT                   /product="LacI-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12392"
FT                   /db_xref="GOA:A0A0E1NV59"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NV59"
FT                   /protein_id="ABG12392.1"
FT                   /translation="MNGKLKIQEIANQTGLSISTVSRVLAGKGNTSAKAKQQVMAYAKS
FT                   QGILQNLSSGRLMLNNIMVFAPHRAFDVRTDIFYYKVIQGITQAVSQHEVMIRYCGLSE
FT                   THSDISLFLDKMTHPQSEAAIIIGIDDPRIHALAASLHKPAVLINCRDKEMSLDSVSPD
FT                   HQSIGEFSAHYLIQQGHRRILTLQCLRRNTMELRLLGIKDAFASNNMRFDDHQHLITTH
FT                   GFGAEEAEQAITTFFTACEDESRLPTAILVGGDYMAVGAVNALNKLNVNVPNRVSVMSM
FT                   DGFNLAEIHDVPLTAVHVPRDELGAEAIQLLQRRVLRPDAPFSNLLLQGKLVVRSSVKQ
FT                   VNQNRAMPAANKPTDQIYDL"
     atgaatggaa agctaaaaat acaagaaata gctaatcaaa cgggtctttc gattagcacg        60
     gtatcaagag tgttagcggg taaagggaat accagcgcca aagcgaaaca gcaggtcatg       120
     gcgtatgcga aatcgcaggg gatcttgcag aatttatcca gcgggcggtt gatgttgaat       180
     aatattatgg tgtttgctcc ccatcgcgct tttgatgtac gaacagatat tttttactac       240
     aaagtcatac aggggatcac tcaggcggtt agccaacatg aagtgatgat ccggtactgc       300
     gggttatccg aaacccacag tgatatttcg ctattcttag ataaaatgac ccacccacag       360
     agtgaggcgg cgattattat tggcattgat gatccacgga tccatgcctt ggccgccagt       420
     ctccataagc cagcggtatt aattaattgt cgcgataaag aaatgtcact ggatagcgtt       480
     tctcctgacc accaatcaat tggcgagttt tctgcccatt acctgataca gcaagggcat       540
     cgccgtattc taacgctaca gtgtttgcgt cgtaatacca tggagttgcg gttgctgggc       600
     attaaagacg cgtttgccag taataatatg cgcttcgatg atcatcagca cctgatcacc       660
     actcatgggt ttggcgctga agaggcggag caggcgataa ccacattttt cacagcctgt       720
     gaggatgaaa gccggctgcc gacggcaatt ttggtcggtg gcgactatat ggctgttggc       780
     gcggttaacg cgctgaataa actcaacgtg aatgtgccca acagggtgtc agtcatgagt       840
     atggacggct ttaacttggc ggaaatccat gatgttccac tgaccgcggt gcatgttcct       900
     cgtgatgaac tgggggcaga ggctatccaa ttgttacagc ggcgggtatt acgcccggat       960
     gcaccgttta gcaacttatt attgcagggt aagctggtgg ttcgctcctc ggtaaagcag      1020
     gtcaatcaga atagggcgat gcctgcagca aataagccga cggatcagat ctatgattta      1080
     taa                                                                    1083
//

If you have problems or comments...

PBIL Back to PBIL home page