(data stored in ACNUC9543 zone)

EMBL: CP000308.PE425

CP000308.PE425       Location/Qualifiers
FT   CDS_pept        complement(494517..495371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0426"
FT                   /product="tagatose-bisphosphate aldolase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12394"
FT                   /db_xref="GOA:A0A0E1NWJ7"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR011288"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWJ7"
FT                   /protein_id="ABG12394.1"
FT                   /translation="MFLVSSREMLRQAQIGGYAIPAFNIHNLETIQAVVETAAEMASPV
FT                   ILAGTPSTFSYAGTEYLVQICQQAARHYRMPFALHLDHHESYDDITQKVAAGIKSIMID
FT                   GSHFNFEQNIALTRQVVEYCHRWDGTVEAELGRLGGQEDDLTVDEKDALYTDPGSAAHF
FT                   IQATGIDSLAIAIGTAHGMYKEAPSLDFDRLALIRRNTDIPLVLHGGSGIPDEDVRRCI
FT                   ELGISKVNVGTELKIAFSGALKAYFLENKGANDPRHYMVPAKAAMKKVIQDKINVCGSA
FT                   GKR"
     atgtttttgg tttcttcccg agaaatgtta cgtcaggcac agatcggagg ctacgcaatc        60
     ccagccttca acatccataa tctggagacc attcaagccg tagttgaaac agcggctgaa       120
     atggcttctc cggtcatttt ggccggaaca ccgagcacct tttcttatgc gggcacggaa       180
     tatctggtgc agatctgcca acaagcggca cgtcattacc gtatgccttt tgcactgcat       240
     ctggatcacc atgagtcgta tgatgatatt acccagaaag tcgcggcggg catcaaatcc       300
     ataatgattg atggctcgca ttttaacttt gagcaaaata tcgcgctgac acgtcaggtg       360
     gtggagtatt gccatcgctg ggatggtact gtcgaagccg aactggggcg tctgggcggt       420
     caggaggatg atctcacggt tgatgagaaa gatgcgctgt atactgatcc tggttcggca       480
     gcacatttta ttcaggcgac agggatagac tctctggcca ttgccatcgg cactgcccat       540
     gggatgtaca aagaggcccc tagcctggac tttgatcgtc tggcgctcat tcgccgcaat       600
     acggatatcc ctctggtact gcatggcgga tcagggatcc cagatgaaga tgtgcgtcgt       660
     tgcattgaat tggggatcag taaagtgaat gtgggtacag agctaaagat cgcattctct       720
     ggtgcactga aagcctattt ccttgaaaat aaaggcgcga atgatccccg tcactatatg       780
     gttccggcta aagccgccat gaaaaaagtg attcaggata aaattaacgt ctgcggcagc       840
     gctggcaaac ggtaa                                                        855
//

If you have problems or comments...

PBIL Back to PBIL home page