(data stored in ACNUC9543 zone)

EMBL: CP000308.PE433

CP000308.PE433       Location/Qualifiers
FT   CDS_pept        complement(503908..504798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0434"
FT                   /product="putative PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12402"
FT                   /db_xref="GOA:A0A0E1NXF2"
FT                   /db_xref="InterPro:IPR004704"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXF2"
FT                   /protein_id="ABG12402.1"
FT                   /translation="MASDITVDKDHTAKAKTDSLVDKIDSYQDLEVRKVVTRKDLWKCA
FT                   IRGLFMEGNFNFERMQAGGFAYSMIPALKKIHGNNRADLAKSLKNHLQFFNASPKLFTF
FT                   LLGTAVAMEENKEKPSMINVMKVAGMGPTGGIGDAIDHMTLMPLTLALGASIAIEGSIA
FT                   GPFVFFILYQTVHFLVYFGLMFMGYRAGTAAMVNMGDATEKLAKAANIMGIFVIGALCA
FT                   TFIRLQTTAAIDLGGKTVELQTALFDKIMPNLLPLALVFFMFKMVKGTGFWAKPPVLIF
FT                   STLAAGVVGHLLGIV"
     atggcatctg atatcaccgt agataaagac cacacggcaa aagcgaaaac ggacagcctg        60
     gtggacaaaa ttgattccta tcaggatctt gaagttcgta aagtggttac ccgtaaagat       120
     ctgtggaagt gcgccatccg tggcctgttc atggaaggta actttaactt cgaacgtatg       180
     caagccggtg gttttgctta ttcgatgatc cccgcgttga agaaaatcca cggtaacaac       240
     cgtgcagatt tggcgaaatc gctaaagaac catttgcagt tctttaatgc cagtccaaag       300
     ctgttcacct tcctgttagg cactgcggtg gcgatggaag agaacaaaga aaagccctca       360
     atgatcaacg taatgaaagt tgcgggcatg gggccaacag gcggtatcgg cgatgccatt       420
     gaccacatga cgctgatgcc actgacgctg gcgctggggg cttctattgc gattgaaggc       480
     tccatcgctg gcccatttgt gttcttcatt ctgtaccaga ctgtgcactt cttggtctat       540
     ttcggcctga tgtttatggg ctaccgcgcg ggcacggcgg caatggtgaa catgggggat       600
     gccacggaga aactggcaaa agccgccaat atcatgggta tctttgttat cggcgcgttg       660
     tgcgccacct ttatcaggct acaaactacc gcggcgatag atcttggcgg gaaaacagtg       720
     gagctacaaa ccgccctgtt tgacaagatc atgccgaatt tactcccgct ggcattggtg       780
     ttctttatgt tcaagatggt gaaaggcacg ggtttctggg cgaaaccacc ggtgttgatt       840
     ttctccacgc tggcggccgg ggtcgtcggt catctgctgg gcattgtcta a                891
//

If you have problems or comments...

PBIL Back to PBIL home page