(data stored in ACNUC9543 zone)

EMBL: CP000308.PE434

CP000308.PE434       Location/Qualifiers
FT   CDS_pept        complement(504788..505576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0435"
FT                   /product="putative PTS permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12403"
FT                   /db_xref="GOA:A0A0E1NPS8"
FT                   /db_xref="InterPro:IPR004700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NPS8"
FT                   /protein_id="ABG12403.1"
FT                   /translation="MLFEATLVGIWAFLCGIDKYDVALNIHRPLITGPVVGLIMGNMEV
FT                   GLIAGATLELAWLGLVPNAGAQPPDVTMGTIAAVAFAVMTGQSPEVAMGVGMPIAVLMQ
FT                   MIIIGFFAMTAFTMGRADKYAEQADTAGISRLLIGTLLTRSMLYFVIAFVTVYFGEHAA
FT                   TWIDENTPTALLEGLGIGAKMVPAIGFAMLLKIMWSKEVAGVFFIGFVMTTYLKLPIMA
FT                   IAILGAAVAVLYYFFSGNNNGSNNNGNNTNKQPEDFEDGI"
     atgctttttg aagctacgtt agtcggaatc tgggccttct tgtgcggtat cgacaagtat        60
     gacgttgccc tgaatattca ccgcccgttg atcaccggcc ctgttgtcgg tttgatcatg       120
     ggcaatatgg aagtgggttt aatcgcaggt gcaacactgg agctggcttg gctcggcctg       180
     gtaccgaatg cgggggctca gccacccgat gtgaccatgg ggactatcgc cgcagttgcc       240
     tttgcggtga tgaccggcca gtcgccagaa gtggcaatgg gcgttggtat gccaattgcg       300
     gtcctgatgc agatgattat tatcggtttc tttgccatga cagcgttcac catgggcaga       360
     gcagataagt atgcagagca ggcagatacg gcgggcatat cgcgcttgtt gataggcacg       420
     ctactcaccc ggtcgatgct ctactttgtg atcgcctttg tcaccgtcta cttcggtgaa       480
     catgcggcaa cctggattga tgaaaataca ccaaccgccc tgttagaagg cttaggtatc       540
     ggtgcgaaga tggttccggc aatcggcttt gctatgttgc tgaaaattat gtggtcgaaa       600
     gaagtggctg gtgtgttctt tatcggcttt gtgatgacga cttacctgaa actgccaatc       660
     atggctatcg ccattctggg tgctgctgtt gctgtcctgt actacttctt cagtggcaac       720
     aataacggca gcaataacaa cggtaacaac accaacaaac aaccagagga tttcgaagat       780
     ggcatctga                                                               789
//

If you have problems or comments...

PBIL Back to PBIL home page