(data stored in ACNUC9543 zone)

EMBL: CP000308.PE435

CP000308.PE435       Location/Qualifiers
FT   CDS_pept        complement(505623..506120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0436"
FT                   /product="putative PTS transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12404"
FT                   /db_xref="GOA:A0A0E1NXD2"
FT                   /db_xref="InterPro:IPR004720"
FT                   /db_xref="InterPro:IPR018455"
FT                   /db_xref="InterPro:IPR036667"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NXD2"
FT                   /protein_id="ABG12404.1"
FT                   /translation="MTRPNIVWTRIDERLLHGQIRITWGKHTEANLILVANDDAADGPN
FT                   SAFMQAGMKASAGGEYAVRFFSIQKTIDVIHKASPQQKVFILCNSPTDVARLVEGGVPI
FT                   TQCNVGNMHYHDGKRQIAKTVSVDEKDLDAFQRMAALGVACTVQNTPDQTPINVIELAA
FT                   RA"
     atgactcggc caaatatcgt ctggactcgt attgatgagc gtttacttca tggacagatc        60
     cgcattacct ggggaaagca caccgaagcc aatttaattc tggtggccaa tgatgacgct       120
     gccgatggcc caaactcggc tttcatgcag gcgggaatga aagcctccgc tggcggtgaa       180
     tatgcagtgc gctttttcag tatccagaaa acaattgatg tcatccataa agcctctcct       240
     cagcagaagg ttttcattct gtgtaactcc ccgacggatg ttgcgcgttt ggtcgaaggc       300
     ggtgtgccaa ttactcagtg caacgtgggc aatatgcact accacgacgg taaacgtcag       360
     attgccaaaa cagtctctgt ggatgaaaaa gatctggatg ctttccaacg tatggccgcg       420
     cttggcgtgg cctgtacggt gcagaacaca ccagaccaaa cgccaatcaa tgtgattgag       480
     ctggccgcca gggcataa                                                     498
//

If you have problems or comments...

PBIL Back to PBIL home page