(data stored in ACNUC9543 zone)

EMBL: CP000308.PE437

CP000308.PE437       Location/Qualifiers
FT   CDS_pept        complement(507301..508599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0438"
FT                   /product="tagatose-bisphosphate aldolase noncatalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12406"
FT                   /db_xref="GOA:A0A0E1NLF2"
FT                   /db_xref="InterPro:IPR012062"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NLF2"
FT                   /protein_id="ABG12406.1"
FT                   /translation="MHPLEKLVQRHKAGEQIGIYSVCSAHPLVIEAALEQALENDSELL
FT                   IEATSNQVDQFGGYTGMTPVDFRDYVFAKADALHFPLEKLILGGDHLGPNRWQHLPANE
FT                   AMAHADDLIAAYVAAGFKKIHLDCSMSCADDPVPLSDEIVAERAARLAAIAEATEYQHF
FT                   NTHTAVYVIGTEVPIPGGATEELDEIEVTSPEAARKTIECHQKAFEKSGVAECWPRVIG
FT                   LVVQPGVEFDHTGVIDFCPEKAHELSKVMDEYDYQVFEAHSTDYQTDDAYRALVKGHFA
FT                   ILKVGPALTFALREALFSLCHIEEELFPAEQCSRLRQVMEDVMLKSPEYWKRYYLGDTE
FT                   QVRLARVYSFSDRMRYYWPMEAVQAAQEKLFANLNSAPIPLPLLSQYMPRQFTAVREGT
FT                   LSFEATALVKQQIKNTLIGYVNACHLFNGNTSK"
     atgcatcctt tagaaaaact ggttcagcgc cataaagccg gggaacaaat tgggatttac        60
     tcagtttgtt ctgcccatcc tcttgtcatt gaagctgcgc tggagcaagc gttagaaaat       120
     gactcagaac tgttaatcga agccacctct aatcaggttg accaatttgg tggctacacc       180
     ggtatgacgc cggttgattt tcgtgattac gtttttgcta aagctgatgc tctgcatttc       240
     cctctcgaaa aactcatttt aggcggcgac catttaggac caaaccgttg gcagcacttg       300
     cctgccaacg aagccatggc gcatgccgat gatctgatcg cggcgtatgt cgcggcgggc       360
     ttcaaaaaaa ttcacctcga ttgcagcatg tcctgcgcag atgatcccgt tcccctctcc       420
     gatgaaattg tagccgagcg tgctgcacgt ctggccgcca ttgcagaagc cacagaatat       480
     caacacttca atacacacac cgccgtttat gtcatcggga cagaagtgcc tatccctggt       540
     ggcgcgaccg aagagttgga tgaaatcgaa gtcacctcac cagaagccgc gcgtaaaacg       600
     attgaatgcc accaaaaagc atttgagaaa tcaggtgttg ctgagtgctg gccacgggtg       660
     attggtctgg tcgtgcagcc tggtgttgag tttgatcaca ccggtgtgat tgatttctgt       720
     ccagagaaag cccatgaact cagtaaagtc atggatgaat acgattatca ggtattcgaa       780
     gcccactcca ccgattatca gaccgatgat gcctatcgcg cactggttaa aggccatttt       840
     gccattctga aagtaggccc ggcgctgaca tttgctctgc gtgaagccct gttcagttta       900
     tgtcatatcg aagaagagtt attcccggca gagcagtgct cccgcctccg tcaggtgatg       960
     gaagacgtaa tgctgaaatc gccggaatac tggaagagat attacctcgg tgatactgag      1020
     caagtgcgct tagcccgcgt ttacagtttc agtgaccgca tgcgctatta ctggccaatg      1080
     gaagccgtgc aggctgcaca agaaaaactg tttgccaatc tgaatagtgc accgattccg      1140
     ctaccactct tgagccagta catgccacgc caatttactg cagttcgcga aggcactctg      1200
     tcttttgaag ccacggcatt ggtcaaacaa caaatcaaaa atacgcttat tggctatgtc      1260
     aatgcatgcc acctttttaa cgggaacaca tcgaaatga                             1299
//

If you have problems or comments...

PBIL Back to PBIL home page