(data stored in ACNUC9543 zone)

EMBL: CP000308.PE438

CP000308.PE438       Location/Qualifiers
FT   CDS_pept        complement(508649..509425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0439"
FT                   /product="DeoR-family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12407"
FT                   /db_xref="GOA:A0A0E1NNT4"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NNT4"
FT                   /protein_id="ABG12407.1"
FT                   /translation="MKAAIERRMEIFNIVTQQGKARVEDLAERFNVSSVTIRSDLSFLE
FT                   KNGYIVRSHGSAIPNTGVIAELTVHEKRRRNSGVKSLIGQAAAKLINSGDTVILDSGTT
FT                   TREIAANLRSVENVVVMTNGLDVAMELASAPGVEVLISGGVLRKSAMSFSGSQAEASLK
FT                   NFRFDKVFLGVDGFDLRVGITTYNEQEASLNRLMCDISEQIIAVADSTKFGKRSCHMIR
FT                   EFGDIDILVTDSDIPEEYVQRLRDMRIEVIIAEKEK"
     gtgaaagcgg caatcgaaag gcgcatggaa atcttcaata tagtaaccca gcaagggaaa        60
     gctcgtgtcg aagatctagc cgaaagattc aatgtctcaa gtgtcaccat tcgtagtgac       120
     ctgagttttt tagagaaaaa cgggtacatc gtcagatcgc acggttcggc tattccgaac       180
     accggcgtta tcgccgagct gactgtccat gaaaagcggc gccgtaattc cggcgtgaaa       240
     tcgctgattg gtcaggcggc ggcgaagctg attaacagtg gtgacaccgt cattctggat       300
     tcagggacaa ccacacggga aattgcggcc aacttgaggt cggtagagaa cgtagtggtt       360
     atgacgaatg gtcttgatgt ggctatggag ttagcatccg ctcccggcgt ggaagtcctc       420
     atctccggtg gtgtgttgcg taagagtgcg atgtcttttt ctggttctca agccgaagcc       480
     agcctgaaaa actttcgttt tgacaaagtt tttctgggtg ttgatggttt tgacttgcga       540
     gttggtatca ccacatataa tgagcaggaa gcgagtctta accgcctaat gtgtgacatc       600
     tcggaacaaa ttattgccgt tgctgattcg accaagtttg ggaaacgcag ctgccacatg       660
     attcgagagt ttggtgatat cgatattttg gtgacggatt cggatattcc tgaagagtat       720
     gtgcagcgac tacgggatat gcgaattgaa gtgatcatag ctgaaaaaga gaaataa          777
//

If you have problems or comments...

PBIL Back to PBIL home page