(data stored in ACNUC9543 zone)

EMBL: CP000308.PE446

CP000308.PE446       Location/Qualifiers
FT   CDS_pept        complement(520391..521341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0447"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12415"
FT                   /db_xref="InterPro:IPR031605"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NR48"
FT                   /protein_id="ABG12415.1"
FT                   /translation="MKAKLLITSGKLLVTSGTAACLGIMAALMPADVQAAQVNATLSWV
FT                   TGDYGTTYDYSGPRLDMTINPDGSNWYYDLGFRKQLHDTDQRYQRMEVSAGYRFRFAEG
FT                   WVQPSFRLREDLSTYASGNRTTINFYDAKVAGQYQLSERFAFVGNMIVGMEREEANTAS
FT                   NLVERNSDRLSWEIEPGIRFKSSANTQMTLNYFNAGKRSDKGETWGLSDDSKNQQVRFY
FT                   FNWNTPIGLVLTPYARYSLDYGETSGWYESAAFSETKTMSKVDRLALQLAYPLSDTFRL
FT                   QAEYYIENVKYQEGYTMGKDDSRVKYMRVGVRATF"
     atgaaagcga agttgttaat cacctctgga aagttgttag tcacctctgg aactgcggcc        60
     tgcctgggaa ttatggctgc cttgatgccc gctgatgttc aggcagcaca agtgaatgca       120
     accctcagtt gggtaacggg ggattatggt acaacttacg attacagcgg tccacgtctg       180
     gatatgacga tcaacccaga tggctctaac tggtactacg atctcggttt tcgtaagcag       240
     ttgcatgata cggaccaacg ttatcagcgt atggaagtaa gtgccggcta tcgtttccgt       300
     tttgctgaag gttgggtcca gcccagtttt cgtctccgtg aagatttaag cacctatgcg       360
     agtggcaacc gcaccaccat taatttttat gatgccaaag ttgcgggaca atatcagtta       420
     tcagaacgtt tcgcctttgt cggtaacatg atagtaggga tggagcgcga agaagcgaac       480
     accgcgtcta acttagttga gcggaattct gatcgtctgt cctgggagat tgagccaggt       540
     atccgtttta aatccagcgc caatacacag atgacactga actattttaa tgcaggtaaa       600
     cgtagcgata agggtgaaac ttgggggtta tctgatgact cgaaaaacca acaggtccgt       660
     ttctacttca actggaatac gccaattggt ctggtgttaa caccttatgc acgttactcc       720
     ctggattatg gtgaaacctc tggctggtac gaaagtgcgg cattcagtga aacgaaaacc       780
     atgagtaaag ttgatcgttt ggcattacag ttagcttacc cattatcaga tactttccgc       840
     cttcaagccg aatattatat tgaaaatgtg aaatatcaag aaggctatac aatgggtaaa       900
     gatgactcac gggtgaaata catgagagta ggtgtaaggg caacattcta a                951
//

If you have problems or comments...

PBIL Back to PBIL home page