(data stored in ACNUC9543 zone)

EMBL: CP000308.PE448

CP000308.PE448       Location/Qualifiers
FT   CDS_pept        complement(521944..522252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0449"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4G2"
FT                   /protein_id="ABG12417.1"
FT                   /translation="MLIFLQNLRFFSTYCHHDSYYFEMIFQRVLSVTDRESKQDMYKTI
FT                   TVGCFVGLMVAWLPPAAVQQYVMQFELLAQRWKTSHTGVPDQTFDDNQLKEIARYPE"
     atgctcatct tcctgcaaaa ccttcggttt ttttcgactt attgtcatca tgattcttat        60
     tatttcgaaa tgatattcca aagagtttta tcggttaccg atagggagag taaacaggac       120
     atgtataaga cgattactgt gggctgtttc gtggggttaa tggtggcctg gctacctccc       180
     gcggcggtac agcagtacgt aatgcagttc gaattgttgg cgcaacgttg gaaaacgtca       240
     cataccgggg tgccagacca gactttcgat gacaatcaac tgaaagaaat tgcgcgttat       300
     ccagaatag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page