(data stored in ACNUC9543 zone)

EMBL: CP000308.PE450

CP000308.PE450       Location/Qualifiers
FT   CDS_pept        524126..524542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0451"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12419"
FT                   /db_xref="GOA:A0A0E1NRK4"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NRK4"
FT                   /protein_id="ABG12419.1"
FT                   /translation="MYVDTVSVVSGSKFIDINGKGVIDYEKEMSLDCCMNKIHFHTRKV
FT                   SIDINEKQKRLVMCLFNDVNRKQDIIKVVWYENHKSISDNNYHQLIHKFRVHLKSFGIP
FT                   EGIIKTINRYGIRLDPSLLITVMSTKMNERFSGY"
     atgtatgttg atacggtttc tgttgtctct ggtagtaaat tcattgatat caatggtaaa        60
     ggagtcattg attatgaaaa agagatgtct ttggattgct gtatgaataa aatccatttt       120
     cacacgagaa aagttagcat tgatattaat gagaaacaaa aaagactggt tatgtgtttg       180
     tttaacgatg taaatagaaa gcaagatatt ataaaagtag tctggtacga aaaccataaa       240
     agtatttcag ataataacta ccaccaatta attcataagt ttagagtgca tttgaaaagt       300
     tttgggatac ctgaaggcat tattaaaaca ataaatagat atggaattag acttgatccg       360
     agtttattaa taacagttat gtccactaag atgaatgaga gatttagtgg ttattaa          417
//

If you have problems or comments...

PBIL Back to PBIL home page