(data stored in ACNUC9543 zone)

EMBL: CP000308.PE452

CP000308.PE452       Location/Qualifiers
FT   CDS_pept        525194..527116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0453"
FT                   /product="general secretion pathway protein D"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12421"
FT                   /db_xref="GOA:A0A0E1NTF5"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NTF5"
FT                   /protein_id="ABG12421.1"
FT                   /translation="MYISGKGIKSIHGMIFLFTLIMPLDIISANFSVSFKDVDIKEFIN
FT                   SVSKNINKTIIIDPTVQGLISIRSYENLDKDTYYQLFLNVLDVYGYAAIEMPHNVLKVI
FT                   SSKRAKGVVAPLPKEGVTFDGDELINRVIPLRYISAKKITPLLRQLNDNTESGSIINYD
FT                   PSNILLITGRAAVVNRLHSIVTDLDQAGDNEIELYKLNYAIAADVVKIVNEAINPINNL
FT                   KQEVSIVGKVIADERTNSILISGDTYIRKKSILMIKKLDKRQSSDGNTKVVYMKYAQAS
FT                   KLLDVLNGISEGFHNEKKTKQSNQWNQRPVAIKAYDQTNALVITADPDMMLALGEVIEK
FT                   LDIRRAQVLVEAIIVETQNGEGINLGVKWENKRSDDINFIKNSDGLLNNNGWGIATTIT
FT                   GLTAGFYKGNWDVLLSALSTNTNNNILATPSIVTLDNMEAEFNVGQEVPVLISTQTTTT
FT                   DKVYNSISRQSIGVMLKVKPQINKGDSVLLEIRQEVSSIADSSTVNTHNLGSVFNKRVV
FT                   NNAVLVKSGETVVVGGLLDKKSSTIVNKVPFLGDLPLIGWLFRQTKEKVEKSNLILFIK
FT                   PTILRESDDYSVVTSKEYNKYKKDNMNGYTLADDIVLSDKKYLSVIPSIRKDINNFYTL
FT                   LDSEL"
     atgtatatta gtggcaaagg aattaaatct atccatggga tgattttttt attcactcta        60
     attatgccat tagacataat aagtgctaat ttttcagtct ctttcaaaga tgtggatata       120
     aaagagttta ttaattcagt aagtaagaat attaataaaa ctattatcat agatcctacg       180
     gtccaagggc ttatcagcat tcgcagttat gagaatttgg ataaagatac gtattatcaa       240
     ctattcttga atgtgcttga tgtctatggt tatgcggcca ttgagatgcc acataatgtc       300
     ctcaaagtga tttcatcaaa aagagccaaa ggagtagtcg caccgctccc aaaagagggg       360
     gtaacattcg atggtgatga attgataaat agagttattc ctcttaggta catatcagca       420
     aagaaaataa cgccattatt gaggcaactc aatgataata cggagtctgg cagtattatt       480
     aattatgacc catctaatat tttgttaatt acagggcgtg ctgcggtagt aaaccgtctg       540
     cattcaatag ttactgatct tgaccaagcc ggagataatg aaattgagct ttataaactc       600
     aattatgcga ttgctgctga tgttgttaaa atagtaaatg aagctataaa tccaataaat       660
     aatttaaaac aagaagtatc aatagtagga aaggttattg ctgatgaaag aacaaactct       720
     atattaatca gcggtgatac atatatcaga aaaaaatcca ttctaatgat aaaaaaactc       780
     gacaagagac aaagtagcga tgggaataca aaagtggttt atatgaaata tgctcaagcc       840
     tcaaagctat tagatgtctt aaatggaata agcgaaggtt ttcataatga gaaaaaaaca       900
     aaacaatcta atcaatggaa tcagagacct gtagcaataa aggcatatga tcagacgaat       960
     gcattagtta ttacggcaga tcctgacatg atgctagcct taggagaagt aatagaaaaa      1020
     ttagatatca gacgtgcaca ggttttggtt gaggctatta ttgtcgaaac tcaaaacgga      1080
     gaaggtatta accttggtgt taaatgggaa aataagcgtt ctgatgatat taattttatt      1140
     aaaaattccg atggtttatt aaataataat ggatggggca tagctacgac aattactgga      1200
     ttaactgctg gtttttataa aggaaactgg gatgtattgc ttagcgcttt atcaacaaat      1260
     acaaataata atatactcgc aactcccagt attgttactc tcgataatat ggaggctgaa      1320
     ttcaatgtgg gtcaggaggt tccagtgctc atatcaacgc aaacgacaac cacagataag      1380
     gtatataatt caatttcaag gcaatctata ggtgtcatgc taaaagtaaa gccacaaata      1440
     aataaaggtg attcggttct acttgaaatc aggcaagagg tgtcgagtat cgctgatagt      1500
     tctactgtta atacacataa tttagggtct gtttttaata aacgagtagt gaataatgca      1560
     gtattagtta aaagtggaga aacagttgtt gttggtggat tacttgataa gaagtctagt      1620
     acgattgtta ataaagtccc cttcttgggt gatctcccat taataggatg gctatttaga      1680
     caaaccaaag agaaagtgga aaaaagtaat cttattctat ttataaaacc gacaatactt      1740
     agggaatccg atgactatag cgttgtgacg tcaaaagaat ataataaata taaaaaagat      1800
     aatatgaatg gatatacttt agccgatgat atagtcctat cagataaaaa atatttaagt      1860
     gttattccta gtattaggaa agatataaat aatttttata cactgttgga ctcagagcta      1920
     tga                                                                    1923
//

If you have problems or comments...

PBIL Back to PBIL home page