(data stored in ACNUC9543 zone)

EMBL: CP000308.PE453

CP000308.PE453       Location/Qualifiers
FT   CDS_pept        527263..528624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0454"
FT                   /product="general secretion pathway protein E"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12422"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4G7"
FT                   /protein_id="ABG12422.1"
FT                   /translation="MAHSPILFNLVTDEEFENNLTERYQNNSADPYQTMSVISNEIDIY
FT                   SFANELSDDDDLLDINDEAPVIKLINSILVEAIKELASDIHIESFDKKLTVRFRIDGVL
FT                   RKILELQRHVALLLVSRIKVMAKLDIAEKRIPQDGRIALNLAGRALDVRVSVLPSSHGE
FT                   RVVMRLLDKNSIKLDLPSLGMSKDNCISMNTQVHKPHGIILVVGPTGSGKSTTLYAALM
FT                   GIDANEKNIMTVEDPIEFDIPGISQTQVNPKIEMTFARSLRAILRQDPDVILIGEIRDI
FT                   ETAQIAVQASLTGHLVLSTLHANSAIGAVTRLKDMNVEAFMLSSSLLAIISQRLVRRLC
FT                   IACRQESSVTEKVLQRLNIDDKCSLVGSVYRAKGCNKCNLTGYRGRIALHEFLVVDNLL
FT                   RGAIYKGLGEFELAKLASGAINSLLSDGISKVIAGLTTIEELVRICQEDDNGCI"
     gtggctcata gtccaatact ttttaattta gttactgatg aagagtttga aaataattta        60
     actgaacgct accaaaataa ttcggctgac ccatatcaga caatgagcgt tatcagcaat       120
     gagatcgaca tttactcttt tgctaacgaa ttatctgacg atgatgattt attggatata       180
     aatgatgaag cacctgtaat aaaattaatc aatagcattc tggtcgaagc aattaaagag       240
     ttagcatctg atatacacat agagtctttc gataaaaaac ttactgtaag atttcgtatt       300
     gatggtgtgt taaggaaaat attggaatta cagcgccatg ttgcactatt attagtgtcg       360
     cgtataaaag tcatggccaa attagatatt gcagaaaaac gtattccaca agatgggcgc       420
     atagctctaa atttagcggg tagagcattg gatgttcgtg tttcggtatt accatctagc       480
     catggtgaac gggtcgttat gcgtttgctt gacaaaaata gcattaaatt ggatttaccc       540
     tcattaggta tgtcgaaaga taactgtatt tctatgaata cgcaggtaca taaaccccat       600
     ggcattatct tggttgttgg cccaacgggt tcgggtaaaa gcactacgtt atatgctgct       660
     ttaatgggga ttgacgcgaa tgagaaaaat attatgactg tagaagaccc tattgagttc       720
     gacatacctg gtatatccca aacgcaagta aacccaaaaa ttgaaatgac atttgctcgt       780
     agcttaaggg caatattacg ccaagatcct gacgttattc ttatcggtga aattcgtgat       840
     attgaaacgg cacagatagc ggtccaagct tctctaaccg gccatttagt tctatctaca       900
     ttacatgcca acagtgcgat aggtgcagtg accagactga aggatatgaa tgtagaggca       960
     tttatgcttt caagttcatt attggccatc atatctcagc ggttggttag aagattatgt      1020
     atagcgtgtc gccaagagtc gtcagtgacg gagaaggtat tacaacgtct gaatattgat      1080
     gataaatgct ctttggttgg ttcggtgtac cgggctaaag gttgtaacaa atgtaatctt      1140
     actggttatc gtggacgtat tgctctccat gaatttctcg tagtggataa cttattgcgg      1200
     ggggctattt ataaagggct aggagagttt gaactggcta aattggccag tggggctata      1260
     aacagccttc tatctgatgg gataagcaaa gttattgcag ggttaaccac tatagaggaa      1320
     ctggtaagaa tatgccaaga ggatgataat ggctgtattt aa                         1362
//

If you have problems or comments...

PBIL Back to PBIL home page