(data stored in ACNUC9543 zone)

EMBL: CP000308.PE454

CP000308.PE454       Location/Qualifiers
FT   CDS_pept        528766..529812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0455"
FT                   /product="putative general protein secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12423"
FT                   /db_xref="GOA:A0A0H2Y575"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y575"
FT                   /protein_id="ABG12423.1"
FT                   /translation="MVKKNSNKTDLVLITRQIATLVNASMPLDEVLDIVGKQNSKSKMI
FT                   EIIQRIRVNIQEGHSFADALSPFPAVFSPLYKTMVTAGEVSGHLGLVLVRLADHIEQTQ
FT                   KIQRKIIQALIYPCVLVLISLSVIIILLTAVVPNIVEQFSFSETALPLSTKVLMILSYS
FT                   IKENVIFIMAIGVSAVIFLNRLLKINKINVFFHRHYLSLPMLGNMFVRINTSRYLRTLT
FT                   TLHSNGVTIVQAMSISNAVLTNVYIKNKLNISVKLVSEGCSLSSSLVDSGVFPPIILHM
FT                   IISGERSGKLDHMLETVAGVQEEELMNQISIVMSLLEPTIIIVMAAFISFVILSILQPI
FT                   LEINSLVM"
     gtggtcaaaa aaaatagtaa taagacggat ttggtattaa ttacacggca gatagcgaca        60
     ttagtaaatg cttcaatgcc actagatgag gttttagata ttgttgggaa acaaaatagt       120
     aaaagtaaaa tgattgaaat aattcaaagg attagagtta atatacagga agggcattca       180
     ttcgctgatg cgctatctcc gtttccagca gtatttagcc cattatacaa aacgatggtt       240
     accgctggag aggtatcagg gcatctggga ttagtgctgg ttcgtcttgc tgatcatatt       300
     gagcagacac aaaaaataca aagaaaaatc attcaggcac ttatctaccc ttgtgtgttg       360
     gttttaatat cactaagtgt cattatcata ttattgacag cggttgtacc gaacatagta       420
     gagcagtttt ctttttcaga gacggcgtta ccattatcaa caaaagtatt gatgatactc       480
     agttatagta taaaagaaaa tgttattttt atcatggcta taggtgtctc ggcagtgatt       540
     tttttaaata gattactaaa aataaataag ataaatgtct tttttcatag gcactattta       600
     agtttgccaa tgctgggtaa tatgtttgtt cgtataaata catctcgtta tcttagaaca       660
     ttaacaacac tacattctaa tggtgtgaca atcgtacagg caatgagtat tagtaatgcg       720
     gtattaacga atgtatatat aaaaaataag ttaaacattt cagttaaatt ggtcagtgag       780
     gggtgtagtt tatcgtcatc tttagttgat agtggagtat tccccccgat catattacat       840
     atgatcatat cgggggagcg tagtggtaag ttggaccata tgctagaaac tgtggcgggt       900
     gtccaggaag aagaactgat gaatcaaata agtatagtaa tgtcattgtt agagccaacc       960
     ataattatag ttatggccgc gtttatttca tttgttattc tgtcaattct tcagccaata      1020
     cttgaaatta atagccttgt catgtaa                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page