(data stored in ACNUC9543 zone)

EMBL: CP000308.PE458

CP000308.PE458       Location/Qualifiers
FT   CDS_pept        531170..531787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0459"
FT                   /product="general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12427"
FT                   /db_xref="GOA:A0A0H2Y4H2"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y4H2"
FT                   /protein_id="ABG12427.1"
FT                   /translation="MKAIKQPMIKRPDCGFTLLEMLLAVVIFSMISFIIYSSLRVTIKS
FT                   NNIMGNKVQELIRLHRVISLLERDISHSVMYIGSQNDYFSNEGRIIGIGVLDSDSFGIY
FT                   MLRNNKINTEIFIHYQHERLGYRLKKNCLERLSYLILKNTNKIETKFSCLIEGINDFRV
FT                   RIFHQGKWLNEWSRIDLSPQGIEIILDVKGVGVIRRFILLLH"
     ttgaaggcta taaaacaacc aatgattaaa cgtccagatt gtgggtttac tttactggag        60
     atgctacttg ctgttgtcat tttctcaatg attagtttta ttatttattc atccttgaga       120
     gtaactatta aaagcaataa tatcatgggg aataaagtac aggaacttat taggttacat       180
     agagttatta gcctattaga acgagatatt tcacattcag ttatgtatat aggatcacaa       240
     aatgattatt ttagtaatga agggcgtatt attggtatag gcgtacttga tagtgacagt       300
     tttggtatct atatgttaag gaataacaaa ataaataccg agatattcat tcattatcaa       360
     catgaaagac tcggttatcg attgaagaaa aattgcctgg aaagattatc ttacttaatt       420
     ttaaagaata caaataaaat agagactaaa ttttcttgcc ttatcgaagg gataaatgat       480
     tttcgtgtga gaatatttca tcaagggaaa tggttaaatg aatggagtag gatagacctt       540
     tctccacaag gcattgaaat catccttgat gttaaaggtg ttggggtgat taggcgattt       600
     attctattgc tacattag                                                     618
//

If you have problems or comments...

PBIL Back to PBIL home page