(data stored in ACNUC9543 zone)

EMBL: CP000308.PE459

CP000308.PE459       Location/Qualifiers
FT   CDS_pept        531796..532752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0460"
FT                   /product="general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12428"
FT                   /db_xref="GOA:A0A0E1NSB3"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSB3"
FT                   /protein_id="ABG12428.1"
FT                   /translation="MNQNGIALLMVLCALFLMSTMVMASYNYWFDIYYLAKNSQQRQKE
FT                   KWILLGAEEKFVSKLIKNTSEDRFNDNEFRRLLSGGRVTVGTWNVNFKSIDNTNCFNIN
FT                   ALKTKISNPEEIIETYSWQVFKYLLLISGVGVKETQDTLERVVELYRSNLVIEQSINGL
FT                   STLKEIPYEADEINISSKMNRADFLKIAPVLCIRGDRKLLVNINMLDAGNSQYLQAALL
FT                   NKVSARDIYDVISAKPNNGWDNIFIFYDLLSSHSPMSARNVNKNILDKLTVDEYFINYI
FT                   FRIDHEDSYYQLITFIHAVGKSIAILNRRYSFSEQHH"
     gtgaatcaaa atggcattgc attactaatg gttttatgtg cactattttt gatgagtaca        60
     atggtaatgg catcatataa ttattggttc gatatctatt atctggcaaa aaatagtcag       120
     caacggcaga aagaaaaatg gatattactc ggtgccgaag aaaagtttgt gagtaaatta       180
     ataaaaaaca cttcagagga tagattcaat gataatgaat ttagacgttt actatcagga       240
     gggagagtta cagtgggtac atggaacgtt aactttaaat caatcgataa tacaaactgt       300
     tttaacatta acgcattgaa aactaaaatt tccaatcccg aagaaatcat tgaaacttat       360
     tcatggcagg tttttaaata cttattgtta atcagcggtg taggagtaaa agaaacacag       420
     gataccctag aaagagtggt tgagttatat cgttcaaacc tcgttattga acagagtatt       480
     aatggactgt caacattaaa agagattccc tatgaggcag atgaaattaa tatttcatct       540
     aaaatgaatc gtgctgattt tttaaaaata gcaccagtgc tctgtattcg aggagatagg       600
     aaattattag ttaacatcaa tatgctagat gcggggaata gtcagtatct gcaagctgct       660
     ttactcaata aagtcagtgc aagagatatt tatgatgtta tttcagcaaa acccaataat       720
     ggatgggata acatttttat attctatgat ttattgtcat cgcattcacc catgagtgct       780
     agaaatgtaa ataaaaacat tttagataaa ttaactgtag atgaatattt tattaattat       840
     atatttagaa ttgatcatga agatagttat tatcaactga ttacttttat ccatgctgta       900
     ggtaagtcaa tagctatttt aaaccggaga tacagtttta gtgagcaaca tcattga          957
//

If you have problems or comments...

PBIL Back to PBIL home page