(data stored in ACNUC9543 zone)

EMBL: CP000308.PE460

CP000308.PE460       Location/Qualifiers
FT   CDS_pept        532736..533926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0461"
FT                   /product="general secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12429"
FT                   /db_xref="GOA:A0A0E1NYM4"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYM4"
FT                   /protein_id="ABG12429.1"
FT                   /translation="MSNIIDDVKLTFTLLIRLGETEFEPIYWYVESQGKKLVRHGKING
FT                   VAELKNITLYANNVVKILVPANKIIFRSLSIKKNEVMNNIKSIAFSIEQSISSDIDNFH
FT                   IVILDQDKDFCHVAAIEHELMNRWLFWLNINGISACCIMPDAFALPFFNSEWSVIKIES
FT                   NWLVRNNEMSGFLVNSSVLENILMLAEPTIKVNTFSPTDIKWGNWQSLDYSDPVLIMAK
FT                   TVSGNHVNLLSGKYKYAERIIVNNSVFLRVASWFFLLFLVMSLNGWYQGYKIVRDTGAL
FT                   SKVAQDFYADFLPPAYHGGDVNTSFNKYISDLDLKKNNVSFIKLLNAVSYYTADENVDV
FT                   RSFNFNYSDGEISFDIEGDDDLINEMLNDKTNLFNARVEVIRSGEDKYNIKLSSQP"
     gtgagcaaca tcattgatga cgtgaaatta accttcacac tccttattcg actaggagaa        60
     acagaatttg aacctatcta ttggtatgtt gaatcacagg gaaagaaatt agtcagacat       120
     ggaaaaatta atggagtcgc tgagttaaaa aatataactt tatatgctaa taatgttgtc       180
     aagattttgg tccccgcaaa taaaatcatt ttcagaagct taagtattaa gaaaaatgaa       240
     gtgatgaata atataaaatc gatagccttc tcgattgaac agtctatttc tagtgatata       300
     gataattttc atattgtgat attagatcaa gataaagact tttgccatgt tgctgctatt       360
     gaacatgaat tgatgaatcg ttggttgttc tggttaaaca taaatgggat atcagcatgt       420
     tgcataatgc cagacgcttt tgctctgccc ttttttaaca gtgaatggag tgttataaaa       480
     attgagagta actggttggt tagaaataat gaaatgtctg gttttttagt taattcgagt       540
     gttttggaaa acatacttat gttagcggaa cccaccatta aagttaatac ttttagtccg       600
     acagatatta aatggggtaa ttggcagtcg ctagactata gtgatcctgt attaattatg       660
     gcaaaaactg tgagtggtaa tcatgttaat ctattgagtg ggaaatataa atatgctgaa       720
     agaataatag ttaacaatag tgtttttttg cgtgttgcca gttggttttt tctcttgttt       780
     ttagtaatga gtttaaatgg ttggtatcaa ggttacaaaa tagtcaggga tacaggggcc       840
     ttaagtaagg tagcacaaga tttttatgct gattttttac cccccgcata tcatggtggg       900
     gatgttaata cgagcttcaa taaatatatt tcagatctgg atcttaaaaa aaacaatgtc       960
     agtttcatta aattattaaa tgctgtaagt tattatacag ctgatgaaaa tgtagatgta      1020
     cgtagtttta atttcaatta ttctgatggt gaaatatctt ttgatattga aggtgatgat      1080
     gatttaataa atgaaatgct aaatgataaa actaatctat ttaatgccag ggttgaggtg      1140
     attcgttctg gagaagacaa atataatatc aaactaagca gccaaccatg a               1191
//

If you have problems or comments...

PBIL Back to PBIL home page