(data stored in ACNUC9543 zone)

EMBL: CP000308.PE464

CP000308.PE464       Location/Qualifiers
FT   CDS_pept        535893..536642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0465"
FT                   /product="putative regulatory membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12433"
FT                   /db_xref="GOA:A0A0H2Y585"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H2Y585"
FT                   /protein_id="ABG12433.1"
FT                   /translation="MNTIVINDVFFTPQKRTIDRNGKVTKIRNKESELLSLLCEYYPEP
FT                   ISREDIEKRLWEGSYVTDNTLTQTISNLRHALDDKKHELVVTIPKKGYRIGIKPEIFIE
FT                   GEVQCQPYEKLGIIGSSVDKMAMSFLKGKMSFYRVCLFVLGVIFFFIFFNVALYRYQVK
FT                   LVDVNSLPILINLDKEQDKTFLSVYQQHPYVLLKKKKMAAMLFVNARETSWYAKKIIYS
FT                   ILFSILLGGGGGNYWYDLCLYTSDEKS"
     atgaatacga tagtgattaa tgatgttttt tttacgccac aaaagagaac gattgatagg        60
     aatggaaagg taactaaaat aagaaacaaa gaatccgaac tattatcttt actttgtgag       120
     tattatccag agccgatatc aagggaggat attgagaaga gactctggga ggggagttat       180
     gttactgata atacattgac tcagacgatc agtaatctac gtcatgcact tgatgataaa       240
     aaacatgagt tagtggttac tattcctaaa aaggggtatc gtatcggtat taaacctgaa       300
     attttcatag agggtgaagt tcaatgtcaa ccttatgaaa aattgggaat aataggttca       360
     tctgtggata aaatggcaat gtctttttta aaaggaaaaa tgtcatttta tagagtctgc       420
     ctatttgtac ttggtgttat tttctttttt atatttttta atgtggcttt gtaccgttat       480
     caagtaaagt tagtagatgt caactcttta ccgatattaa ttaatttgga taaagaacaa       540
     gataaaacgt ttttatctgt ttatcagcag catccttatg ttttactgaa aaagaaaaaa       600
     atggcggcta tgttgtttgt aaacgccagg gagacgagtt ggtatgcgaa aaaaataatt       660
     tattcgatat tgttttctat tctccttggg ggaggggggg gcaattattg gtatgattta       720
     tgcctatata catccgatga aaaatcttga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page