(data stored in ACNUC9543 zone)

EMBL: CP000308.PE465

CP000308.PE465       Location/Qualifiers
FT   CDS_pept        536605..537006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0466"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12434"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NSW4"
FT                   /protein_id="ABG12434.1"
FT                   /translation="MIYAYIHPMKNLEGYWEGNYLLRTDSGNYHIFSRVNIINRSIQSS
FT                   MDVYDDRDQVKARCNTLFNIRSANNVFCVKMLSISFVDNEEKMLSDFLNTPYDVSYPIF
FT                   YRLDANTILIEQSQGHPVNSTRLLVRANI"
     atgatttatg cctatataca tccgatgaaa aatcttgaag gctactggga gggaaattac        60
     ctattaagaa ctgatagtgg taattatcat attttttccc gtgttaatat tattaatcgc       120
     tcgatacaat cgtctatgga tgtttatgat gaccgcgacc aggtaaaagc cagatgcaat       180
     actctattta atatccgaag tgctaataat gttttctgtg ttaaaatgtt gtctatttcc       240
     tttgttgata atgaagagaa aatgcttagt gacttcctta atactcctta tgatgtgagt       300
     tatccaattt tttatcgttt ggatgctaat actattttga ttgaacagtc tcaagggcat       360
     ccggttaaca gtactcgatt actggttcgt gccaatatat aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page