(data stored in ACNUC9543 zone)

EMBL: CP000308.PE467

CP000308.PE467       Location/Qualifiers
FT   CDS_pept        complement(538838..539473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12436"
FT                   /db_xref="GOA:A0A0E1NYE8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NYE8"
FT                   /protein_id="ABG12436.1"
FT                   /translation="MPGTTLHYIFDPLCGWCYGAAPLVQTAQNIPGLTLVLHGGGMMSG
FT                   ANRRQIDTQWRSYVMPHDKRIAELTGQTFGDNYFNQLLNDTSAIMDSTPPIAAILAAEA
FT                   LAGDGAKMLHRIQLAHYVEGRRIADTPVLTVLAADIGLNTEAFINAFNIAQKHAAQHIA
FT                   ESRTMLAKVQGHGFPTFILQDAAGKMTVVPAGDYFGNQPGWINRLTNA"
     atgcccggta caacattgca ctatattttc gacccgctat gtggatggtg ctatggcgcg        60
     gcccccttgg tacaaacagc ccaaaacatt ccaggcttga cgctggtatt gcacggaggt       120
     ggcatgatgt ctggtgcaaa ccgccgccaa attgataccc aatggcgcag ctatgtcatg       180
     cctcatgata aacgtattgc agaattgacc ggacagactt ttggcgacaa ttatttcaac       240
     caattactga atgatacttc ggcaataatg gattctacgc cccctattgc cgccatttta       300
     gcagcagaag cactggcggg tgatggagca aaaatgctac atcgtatcca actagcacat       360
     tatgttgaag gccgccgtat tgccgataca cccgtactaa ccgtgctcgc cgcagatatt       420
     ggcctgaata cagaggcttt tatcaatgct tttaacattg cccaaaaaca tgctgcacaa       480
     catattgcgg aaagccgaac catgctagca aaagtgcaag ggcacggctt cccaacattt       540
     atattgcaag atgctgcagg caagatgaca gttgtacctg caggcgatta tttcggtaat       600
     caaccgggtt ggatcaacag gttaactaac gcgtga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page