(data stored in ACNUC9543 zone)

EMBL: CP000308.PE47

CP000308.PE47        Location/Qualifiers
FT   CDS_pept        complement(62749..64236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="YPA_0047"
FT                   /product="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:YPA_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ABG12016"
FT                   /db_xref="GOA:A0A0E1NWM9"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0E1NWM9"
FT                   /protein_id="ABG12016.1"
FT                   /translation="MNKEILAVVEAVSNEKSLPREKIFEALETALATATKKKYEQEIEV
FT                   RVSIDRKTGDFDTFRRWVAVDEVTMPTREITLDAAQFEDPSLQLGDYVEDQIESVTFDR
FT                   ITTQTAKQVIVQKVREAERAMVVEQFRQYLGQIVTGIVKKVSRDSIALDLGHNAEAVIG
FT                   REDMLPRENFRPGDRIRGVLYDVRPEARGAQLFVSRSRSEMLVELFRIEVPEIGEELIE
FT                   IKAAARDPGSRAKIAVKTNDKRIDPVGACVGMRGARVQAVSSELGGERIDIVLWDDNPA
FT                   QFVINAMAPADVASIVVDEDKHTMDVAVEASNLAQAIGRNGQNVRLAAQLSGWELNVMT
FT                   ADDLQAKHQAEAHAAIDTFTKYLDIDEDFATVLVEEGFSSLEELAYVPMKELLEIDGLD
FT                   EDTVEALRDRAKAALTTLALAQEESFGDQKPADDLLNLAGLERSMAFKLAARGVCTLED
FT                   LAEQGIDDLADIEGLSDEQAGELIMAARNICWFGDNA"
     atgaacaaag agattctggc tgttgtagaa gcagtttcca atgagaaatc ccttccgcgc        60
     gagaagattt ttgaggcgtt ggaaaccgct ctagcgacag caaccaagaa aaaatacgaa       120
     caagagattg aagtccgcgt cagtattgac cgtaaaaccg gtgattttga tactttccgc       180
     cgttgggtcg ctgttgacga agtgactatg ccaacccgtg aaatcacgtt ggatgcggct       240
     caatttgaag atccttctct ccaattgggt gattatgtcg aagaccagat tgaatcggtg       300
     acttttgacc gcattaccac ccaaacagcc aagcaagtca tcgtacaaaa agtacgtgaa       360
     gctgaacggg cgatggttgt tgagcagttc cgtcaatatc tggggcaaat tgtcactggt       420
     attgttaaga aagttagccg tgacagtatt gcactggatc tgggccacaa tgcggaagct       480
     gttattggtc gtgaagatat gctcccgcgt gaaaatttcc gcccaggtga ccgtatccgt       540
     ggtgttctgt atgacgtgcg tccagaagct cgtggcgcac agttgtttgt cagccgttca       600
     cgttctgaaa tgttggtcga actgttccgc attgaagtac cagaaattgg tgaagagctg       660
     atcgaaatta aagccgctgc ccgtgatcct ggctctcgtg ctaaaattgc ggtcaaaacc       720
     aatgacaagc gtatcgatcc ggttggtgct tgcgttggta tgcgtggtgc ccgtgttcag       780
     gctgtgtcca gcgagcttgg cggcgagcgc attgatattg tattgtggga tgataatcca       840
     gcccagtttg ttattaacgc tatggcgcca gctgatgttg cgtctattgt ggttgatgaa       900
     gacaaacaca cgatggatgt tgccgttgaa gccagtaatt tggcccaggc aattggtcgt       960
     aatggccaga acgtacgttt agccgcgcag cttagtggct gggaactgaa cgtaatgacg      1020
     gcggacgatc ttcaggcgaa gcatcaggcc gaggctcatg ccgctattga taccttcact      1080
     aaatatcttg atatcgatga agactttgcc accgtattgg tagaagaagg tttctcttct      1140
     ctggaagagt tggcttatgt gccaatgaaa gaacttctgg aaatcgatgg tcttgacgaa      1200
     gatacggttg aagcgctgcg tgatcgcgcc aaagctgcat tgaccacgct ggccctggca      1260
     caagaagaaa gttttggcga ccagaaaccc gctgatgacc tgttgaattt agcgggtctg      1320
     gaacgtagca tggcattcaa attggctgcg cgcggtgtat gtacgctgga agatcttgcc      1380
     gagcagggta tcgacgattt ggcagatatt gaagggctta gcgatgagca agccggtgag      1440
     ctgattatgg ccgcacgtaa tatctgttgg tttggcgata atgcgtaa                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page